KEGG   Pleurocapsa sp. PCC 7327: Ple7327_2086Help
Entry
Ple7327_2086      CDS       T02367                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Ple7327_2086
Enzymes [BR:plp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Ple7327_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2244475..2245035
Genome map
AA seq 186 aa AA seqDB search
MLKLYGGVRSRASIVQWYLEELGIPYEFVLLDMEAGEHRKPDFLAINPIGKVPAIVEGDF
RLWESGAILLYLAEKYGKMPESLEGKSTIAQWVIFANSTLATGLFVESVREQETPKLLTP
LNQIFDRQPFLLGDEFTVADVAVGSILAYVPMMLKLDLSEYPAVLGYIQRISERPAFGKT
IGKRSA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaactttacggcggcgttcgttctagagcttccatcgtccagtggtatttggaa
gaattaggaattccttacgaattcgtcctgctcgatatggaagccggagaacaccgaaaa
ccagattttctggcaattaatcccataggaaaagttcctgcgattgttgagggagatttt
cggctttgggaatcgggagcgattttgctttatttagcagaaaaatacggcaaaatgccc
gaatctttggaggggaaaagcacgatcgctcaatgggtaatttttgccaattcaaccttg
gcgacgggactttttgtcgaaagcgttcgggagcaggaaacgccgaagttattgacaccg
ctcaatcagatcttcgatcgccagccatttctattaggcgacgagttcactgtggctgac
gttgccgtcggctcgattttggcttacgtgccgatgatgctaaagctagatttgagtgaa
tatccagccgttttaggctatatccagagaatttccgaacgacctgcctttgggaaaaca
ataggtaagcgttctgcctaa

DBGET integrated database retrieval system