KEGG   Pleurocapsa sp. PCC 7327: Ple7327_2450Help
Entry
Ple7327_2450      CDS       T02367                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:plp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:plp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:plp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:plp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:plp00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:plp00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2643159..2644220
Genome map
AA seq 353 aa AA seqDB search
MAILLAGDIGGTKTILRLVKAEQTETTYKFPTLTTLYEQTYSSKEFPDLVPIVCRLLEAA
TEQLGERPIVEKACFGIAGPVTNNTAKLTNLSWSLEGDRIERELSISQVSLINDFAAIGY
GVLGLSEQDLYALQTVESDRNAPIAILGAGTGLGEGFLIPLSDDSYRVFSSEGGHVDFAP
HSTLEFQLLNYILEKNNLERVSVERIVSGQGIVSIYQFLWDRDSSQSSPTFAKIYQTWLQ
ELGKEEKTVDLAAEISKAAIAQSDRLCQQTMRLFVEAYGAEAGNLALKLLPYGGLYIAGG
ISAKILSLLKQGDFMKAFKAKGRVSPILNKIPVYVVLNPKVGLIGAAFRAAQI
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcaattttactagctggagacattggcggcacaaaaactatcttgcggttggttaaa
gcggaacaaacggaaacaacgtataaattcccaaccttaaccacgctttacgagcaaact
tattcgagtaaagagtttcccgacttagtgccaatcgtatgtcggttgctagaggcagcg
acagaacaattgggagaacgaccaatagttgaaaaagcttgctttggcattgccggacca
gtaaccaacaatactgcgaaactgacaaatttaagttggtcgttggagggcgatcgcatc
gagagagaattatctatttctcaagtatctctcattaatgattttgctgctattggttac
ggtgtgttgggattatccgagcaagatttgtatgcgctacagacagtcgaaagcgatcgc
aatgctccgatcgctattctaggagcgggaacaggattaggagaaggatttttaattcct
ctctcagacgacagctatcgcgtctttagcagcgaaggaggtcatgtagattttgccccc
cattctaccctagagtttcagttactcaattatattttggagaagaataatttagagcga
gtttctgtcgaacgaatcgtatctggacaaggaatcgtctcaatttatcagtttttatgg
gacagggatagttctcaatcctctcctacctttgccaaaatctatcaaacttggttgcaa
gaactcggcaaggaagagaaaaccgtcgatttagcagcagaaatttccaaagcagcgatc
gcgcaaagcgatcgtctgtgccaacaaaccatgaggctatttgtagaagcttatggagca
gaagcaggaaacctagcgctaaaattattgccctatggcggactctacattgctggtggc
atttctgccaagattttatctctcttgaagcaaggagactttatgaaagctttcaaagct
aaaggaagagtcagtcccattctcaataaaattcccgtctatgtggttctcaatccaaaa
gttggactgattggagctgcctttcgtgccgctcaaatctag

DBGET integrated database retrieval system