KEGG   Pleurocapsa sp. PCC 7327: Ple7327_2460Help
Entry
Ple7327_2460      CDS       T02367                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ple7327_2460
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ple7327_2460
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Ple7327_2460
Enzymes [BR:plp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Ple7327_2460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2652605..2653714
Genome map
AA seq 369 aa AA seqDB search
MPQTIVVKIGTSSLTQVATGKLALSTIAALVETLTRLRTAGYRVVLVSSGAVGVGCARLN
LSERPRKMSLKQAVAAVGQGRLIRVYDDLFTSLGQPIAQVLLTRRELMDRSCYVNAYNTF
QALFELGVIAIVNENDTVAVEELKFGDNDTLSALVASLIEADWLFILTDVDRLYSADPRL
VPDAKPIALVNSTDFAQLQVEAGSSGSRWGTGGMATKLSAARIATSAGVRMVITRGRQPE
NIEKILRGEPIGTQFEAQPRTENARKRWIAYGLIPMGKLYLDRGAVEAICKGSKSLLAAG
ITRVKGDFVASEAVQLCDAGGKEIARGIVNYNSAEIELIKGHHSEKIPAILGYAGAETVV
HRDNLVLLD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgccccaaactatcgttgtcaaaattggtacttccagtctcacccaagtagcaacgggt
aaactagccctctctaccattgctgctttggtagaaaccctcacccgcctgcgaacggcg
ggatatcgagtcgttttagtttcttcgggggcagtgggagttggctgtgccagactgaat
ttaagcgagcgaccgcgcaagatgtcgctcaaacaagcagtagctgctgtcggtcaggga
cggttgattcgcgtgtatgacgacttattcaccagtctcggacaaccaatcgctcaagtg
ttgttaactcgccgggagctaatggatcgcagttgctatgtcaatgcttacaataccttc
caggcgcttttcgaattaggcgttattgcgattgtcaacgaaaatgataccgttgccgtg
gaagaactcaagttcggcgataacgatacgctctcagccttagttgctagcctcatcgag
gctgactggctatttatcctcaccgacgtagatcgactgtattctgccgacccgcgcctc
gttcccgatgccaaaccgatcgcgctagtcaactctacagactttgcccagttacaagta
gaagcaggttcgagcggttcccggtggggaacggggggaatggcaactaaattatcggct
gctcgcattgccaccagtgctggcgtaagaatggtcattactcgcggcagacagccggaa
aatatcgaaaaaatattgcgcggagaaccaataggaacgcagtttgaggcgcaaccgaga
acagagaatgcccgcaagcggtggattgcctatggattaattccgatgggaaaactctat
ctcgatcgcggcgcggtggaggcaatctgcaagggcagtaaatctttgttagcagcggga
attacccgcgttaagggagattttgtcgcttccgaagccgtacagttgtgcgatgcaggc
ggcaaagaaattgctagaggaattgttaattacaacagtgcggagatcgaactgattaaa
gggcaccactcagagaagattcccgcgatcttaggctatgctggtgccgaaacggtggtg
catcgcgataacctcgtgcttttggattga

DBGET integrated database retrieval system