KEGG   Pleurocapsa sp. PCC 7327: Ple7327_3112Help
Entry
Ple7327_3112      CDS       T02367                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
plp00010  Glycolysis / Gluconeogenesis
plp00020  Citrate cycle (TCA cycle)
plp00620  Pyruvate metabolism
plp01100  Metabolic pathways
plp01110  Biosynthesis of secondary metabolites
plp01120  Microbial metabolism in diverse environments
plp01130  Biosynthesis of antibiotics
plp01200  Carbon metabolism
Module
plp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ple7327_3112
   00020 Citrate cycle (TCA cycle)
    Ple7327_3112
   00620 Pyruvate metabolism
    Ple7327_3112
Enzymes [BR:plp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ple7327_3112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase MadL Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID: AFY78342
UniProt: K9T650
Position
3338224..3339552
Genome map
AA seq 442 aa AA seqDB search
MLSGISICRPLLVNWENRSMIHDIFMPALSSTMTEGKIVSWLKSPGDKIEKGETVLVVES
DKADMDVESFNEGYLAAILVEAGQEAAVGEPIALIAETEAEIEQAKQQAASRLGAPAPTP
AAAPTTPKPAFVESEAPVAAVPTNRSNGRTVVSPRAKKLAKELGVDLKTLQGSGPHGRIV
AEDVERAAGKTPSLTIAPTPAVQPTTPSVTPQPQVAIPVGETVPLTTLQKAVAQNMVASL
QAPTFHIGYTVTTDGLDKLYQQIKSKGVTMTALLAKAVAVTLQKHRIVNASYTEQGIQYH
AAINVAVAVAMPDGGLITPVLQNADQLDIYTLSRTWKDLVDRARAKQLQPEEYNSGTITI
SNLGMFGVDRFDAILPPGQGAILAIGASRPQVVATSDGMFGVKNQMSLNITCDHRVIYGA
QAAAFMQDLAKLIEGNPQSLTL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgctatctggcattagtatttgtcgtccgttactcgttaattgggaaaaccgctccatg
attcacgatattttcatgcctgccctcagctccaccatgaccgaaggaaagatcgtctct
tggctcaaatctccaggcgataaaattgaaaaaggcgaaacggtattagtggtcgagtcg
gacaaagctgacatggacgttgaatcgttcaatgaaggctatttagctgctatcctagtc
gaagccggacaagaagcggctgtcggcgaacctattgctctaattgcagaaaccgaagca
gaaatcgagcaagccaagcagcaagcagcttctcgcttaggtgctccagcccccacacct
gctgccgcaccaacaacacccaaaccagcttttgtagaaagtgaggcgcccgtcgctgcc
gttccaactaaccgcagcaatggacgcaccgttgtttctcctagagcgaaaaagctggca
aaagaattgggagttgacctaaaaaccctacagggtagcggtccccatggcagaatcgtc
gctgaagatgtggaaagagccgctggaaagaccccatctctgacaattgcaccaacgcca
gccgttcaaccgacaaccccctccgttacaccccagcctcaagtagccattcccgttggc
gaaaccgtaccattgaccactctacaaaaggcagtggcacaaaatatggttgccagcttg
caggctcccacgttccacataggctacaccgttacgaccgacgggttggataaactgtat
caacagataaaatctaaaggcgtgacgatgacggcattgttggcaaaagcggttgccgtt
actttgcagaaacatcgcattgtcaacgctagctataccgaacagggaattcagtatcac
gcagccattaatgttgccgtagcagtggcaatgcccgatggcggactcattacccccgtc
ttgcaaaacgccgaccaactggatatttacaccctctctcgaacctggaaagatttggta
gaccgagccagagccaaacaactccagccagaagagtacaatagcggtacgatcactatt
tctaatttagggatgtttggagtcgatcgctttgatgcgattcttcctcccggacaaggg
gcaattctggcaattggagcttctcgtccccaggttgtcgcaacctcggatggcatgttt
ggcgttaaaaatcagatgagcctcaatatcacctgcgatcatcgcgttatctacggcgca
caagcagctgctttcatgcaagacttggcgaagttaattgaaggcaatcctcaatccctc
acactttaa

DBGET integrated database retrieval system