KEGG   Pleurocapsa sp. PCC 7327: Ple7327_3112Help
Entry
Ple7327_3112      CDS       T02367                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ple7327_3112
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ple7327_3112
   00020 Citrate cycle (TCA cycle)
    Ple7327_3112
   00620 Pyruvate metabolism
    Ple7327_3112
Enzymes [BR:plp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ple7327_3112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3338224..3339552
Genome map
AA seq 442 aa AA seqDB search
MLSGISICRPLLVNWENRSMIHDIFMPALSSTMTEGKIVSWLKSPGDKIEKGETVLVVES
DKADMDVESFNEGYLAAILVEAGQEAAVGEPIALIAETEAEIEQAKQQAASRLGAPAPTP
AAAPTTPKPAFVESEAPVAAVPTNRSNGRTVVSPRAKKLAKELGVDLKTLQGSGPHGRIV
AEDVERAAGKTPSLTIAPTPAVQPTTPSVTPQPQVAIPVGETVPLTTLQKAVAQNMVASL
QAPTFHIGYTVTTDGLDKLYQQIKSKGVTMTALLAKAVAVTLQKHRIVNASYTEQGIQYH
AAINVAVAVAMPDGGLITPVLQNADQLDIYTLSRTWKDLVDRARAKQLQPEEYNSGTITI
SNLGMFGVDRFDAILPPGQGAILAIGASRPQVVATSDGMFGVKNQMSLNITCDHRVIYGA
QAAAFMQDLAKLIEGNPQSLTL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgctatctggcattagtatttgtcgtccgttactcgttaattgggaaaaccgctccatg
attcacgatattttcatgcctgccctcagctccaccatgaccgaaggaaagatcgtctct
tggctcaaatctccaggcgataaaattgaaaaaggcgaaacggtattagtggtcgagtcg
gacaaagctgacatggacgttgaatcgttcaatgaaggctatttagctgctatcctagtc
gaagccggacaagaagcggctgtcggcgaacctattgctctaattgcagaaaccgaagca
gaaatcgagcaagccaagcagcaagcagcttctcgcttaggtgctccagcccccacacct
gctgccgcaccaacaacacccaaaccagcttttgtagaaagtgaggcgcccgtcgctgcc
gttccaactaaccgcagcaatggacgcaccgttgtttctcctagagcgaaaaagctggca
aaagaattgggagttgacctaaaaaccctacagggtagcggtccccatggcagaatcgtc
gctgaagatgtggaaagagccgctggaaagaccccatctctgacaattgcaccaacgcca
gccgttcaaccgacaaccccctccgttacaccccagcctcaagtagccattcccgttggc
gaaaccgtaccattgaccactctacaaaaggcagtggcacaaaatatggttgccagcttg
caggctcccacgttccacataggctacaccgttacgaccgacgggttggataaactgtat
caacagataaaatctaaaggcgtgacgatgacggcattgttggcaaaagcggttgccgtt
actttgcagaaacatcgcattgtcaacgctagctataccgaacagggaattcagtatcac
gcagccattaatgttgccgtagcagtggcaatgcccgatggcggactcattacccccgtc
ttgcaaaacgccgaccaactggatatttacaccctctctcgaacctggaaagatttggta
gaccgagccagagccaaacaactccagccagaagagtacaatagcggtacgatcactatt
tctaatttagggatgtttggagtcgatcgctttgatgcgattcttcctcccggacaaggg
gcaattctggcaattggagcttctcgtccccaggttgtcgcaacctcggatggcatgttt
ggcgttaaaaatcagatgagcctcaatatcacctgcgatcatcgcgttatctacggcgca
caagcagctgctttcatgcaagacttggcgaagttaattgaaggcaatcctcaatccctc
acactttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system