KEGG   Pleurocapsa sp. PCC 7327: Ple7327_3277Help
Entry
Ple7327_3277      CDS       T02367                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ple7327_3277
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ple7327_3277
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ple7327_3277
Enzymes [BR:plp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ple7327_3277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3528974..3530281
Genome map
AA seq 435 aa AA seqDB search
MTQATQTQTPSTFTPTFTKLVSKEGGTEYPLKALHICEETFAPLEVAYDYDLIRRQVSRE
SIQAGPNSIWRYRAFLPVATENPIDVGTGMTPLVKSHRLARRLGLKNLYIKNDAVNMPTL
SFKDRVVSVALTRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLG
TLIYNPTVMAVKGNYDQVNRLCSEVGNTYGWGFVNINLRPYYSEGSKTLGFEVAEQLGWK
LPDHIVAPLASGSLYTKIYKGFQEFVKVGLVEDKNVRFSGAQAEGCSPIAQAFREERDFV
TPVKPNTIAKSIAIGNPADGIYALEIARKTGGNIESVTDAEIVEGIKLLAETEGIFTETA
GGTTVAVLKKLVEAGKIDPDETTVVYITGNGLKTQEAVQGYIGEPLVIEPKLDSFERALE
RSRTLERLEWQQVLV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggcaacccaaactcaaaccccatctacttttactcccaccttcaccaagcta
gtttctaaagaaggaggaaccgaatacccgcttaaagctctccatatttgtgaggaaacc
tttgcgcctctagaagtggcttacgactacgacctcattcgccgccaagttagtcgcgaa
agcatccaagcgggaccaaactcaatttggcgctatcgggcatttctccccgtcgctact
gaaaatcctattgacgtgggaactgggatgactcccctagtcaaatctcatcgcttggcg
cgtcgcctgggtttgaagaatctctacatcaaaaatgatgccgtcaatatgcctaccctc
agcttcaaggatagggtagtatccgttgcgctgactcgcgcccgcgaactaggatttaca
acggtttcctgtgccagtacgggtaacttagctaattctactgccgcgatcgcagctcat
gcaggattagattgctgcgttttcatccctgcggatctcgaagctggaaaagtcctaggc
actttaatttacaatcctactgtcatggcggttaaaggcaattacgaccaagtaaaccgc
ctgtgttcggaagtgggtaatacctatggatggggatttgtcaacatcaacttgcgtccc
tactattctgaaggctcaaagacattaggatttgaagttgccgaacagttgggatggaaa
cttccggatcatatcgttgcgcctctcgcatctggttctttatacaccaagatttacaag
ggcttccaagagttcgttaaagttggcttagtagaagataaaaacgttcgctttagcggc
gcacaagcagaaggatgttctcccatcgcgcaagctttcagggaagaaagagactttgtt
acgcctgtcaaacccaatacaattgccaagtctattgccattggcaacccggctgacggg
atttatgcactagaaattgcgaggaagacaggtggtaatattgaatcggttactgatgcc
gaaattgtcgaaggaatcaagttactagccgaaaccgaaggaatcttcaccgaaaccgca
ggcggtacgactgttgcagtattaaagaaattggtagaagccggaaaaatcgaccccgat
gaaactacagtagtttatattacgggtaacggactcaagactcaggaagccgtgcagggt
tacattggcgaacctctagtcattgagccaaaattagatagtttcgagcgtgctttagaa
cgttctcggacgctagaacgccttgaatggcaacaagttttggtttag

DBGET integrated database retrieval system