KEGG   Pleurocapsa sp. PCC 7327: Ple7327_3646Help
Entry
Ple7327_3646      CDS       T02367                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:plp01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:plp00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3884444..3885328)
Genome map
AA seq 294 aa AA seqDB search
MQIRRRPPNPAVEVESLRYTIKVPDGDPRHILEEIVWHKEKEVDRLRERLPLLELRKQVQ
DLPPPYDFLAALKQGKTQPALIAEVKKASPSKGVIREDFDPVEIALAYQQGGASCLSVLT
DEKFFQGSFDNLALVRQAVDLPLLCKEFIIYPYQIYLARSKGADAVLLIAAILSDKDLQY
FVKIINALGMVALVEVHTLTELDRVLAIEGVRLVGINNRNLENFSVDLQTTCQLLEARRE
QLQRRDILVVSESGLHAPADLNLVKNAGADAVLIGESLVKQPDPKDAIAALFTI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattagaagaagacccccaaatcccgctgttgaagtcgaaagccttcgctatacc
attaaagtgcctgatggagacccccggcatattttagaggagattgtttggcataaagaa
aaagaagtcgatcgcctgcgcgaacgattgcctctactggagttgcgcaagcaggtccaa
gatttaccgcctccttatgacttccttgccgcactcaagcagggaaaaacccaacccgct
ttgattgcagaagtcaaaaaagcctctcccagcaaaggagtcatccgcgaagacttcgat
ccggtggaaattgcacttgcctatcaacaagggggagctagttgtttgtcggtattgacg
gatgaaaagttttttcagggaagttttgacaatctagccctagtccgtcaagcagtcgat
ttgcccttactgtgcaaagaatttattatctatccctaccaaatttatctcgctcgcagc
aagggagcggatgccgtcttgctcattgctgccattttaagcgacaaggacttgcaatac
tttgtcaaaattatcaacgctttgggcatggtagctttggtcgaagtccatactttgaca
gagttagatcgggtattggcgatcgaaggcgttcgcttagtcggaattaacaatcgcaat
ttagaaaatttttctgtcgatttgcaaacgacttgccaattgttggaagcaaggcgagaa
caactgcaacggcgagatattttagtggtgagcgaatctggattacatgcgcctgccgat
ctcaatttagtcaaaaatgcgggtgccgatgccgttttaattggagagtcactcgtcaaa
caacccgatcccaaagacgcgatcgcggcattgtttactatttaa

DBGET integrated database retrieval system