KEGG   Pleurocapsa sp. PCC 7327: Ple7327_3684Help
Entry
Ple7327_3684      CDS       T02367                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:plp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:plp00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:plp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3923357..3925246
Genome map
AA seq 629 aa AA seqDB search
MAIEIRNNNTNSKYVGLNKLTEAISMLSSQSTSAQRNTDSNTLINDVASGDTTQTSTVLW
ARSTADGEITFEYSTEPNFDTVAGTTTATVTDTNLPAKVQINGLQPGTKYYYRVTDAAGT
TATGQFKTAAELGAQAGFRFGAAGDWRGELSPYPSISNAPQRDLDLFVEHGDTIYADVPS
DAVKNPDGTRKEQAETLDEYRAKHAEVYGDRLGFNTWGDLRSSTSILATIDDHEVINDFS
GGAPANTDPRFGETTGLINDTQLFENGLQAFQEYNPIRDEFYGQTGEERTSEERKLYRYN
TYGSDAAVIVLDNRSFRDAPLEEANLLDSEDVTRFLRESLTRDRTMLGAPQLADLKRDLL
AAENNGITWKFVMVPEPIQNFGPALAADRFEGYAQERSEILRFIQENNIDNVVFVAADIH
GTVVNNLTYQEAPGEEQIATGAFEISTGSVAFNPPLGFVLADITTAIDPEARALYDSLPV
ANDPDSTVNDKDDFIKQIINEQLQPLGYDPIGLNDNLPNADGLINATLLQGDYVAAHTFG
WTEFDVDPQTQQLKVTTYGIEPYSEAELLVNPSEITSRTPTIVSEFVVNPVIDSGASAPE
PQTIYGTLNDDTFNAAIALTPESLLGTSF
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgaaattcggaacaataacaccaactccaaatatgtcggtttgaataagttg
actgaggcaatttctatgttaagctcccaatctacttccgctcagcgcaatacggattct
aatactcttattaacgacgttgccagcggcgatacgacccagacttccaccgttctctgg
gcacgcagtactgctgatggcgagataacatttgaatattctacagaacccaacttcgac
actgttgcggggacaacaacagcaaccgtcaccgatactaaccttcccgcgaaggtacaa
attaacggactgcaaccgggaactaaatattactatcgcgtcaccgatgcggctgggaca
acggcaacaggacagtttaaaaccgcagccgaattaggtgcccaagcaggctttcgtttt
ggggcagcaggggactggagaggcgaactctctccctatccctcgattagcaatgccccg
caacgggatctcgacctgtttgtcgaacacggcgataccatctatgccgacgtcccttcc
gatgctgtcaaaaatcccgacggcacccgcaaggaacaagcagaaactctagatgaatat
cgggcaaaacacgcggaagtctatggcgatcgtttagggtttaatacatggggcgatctg
cgttcttctacctccattctcgccaccatcgacgaccacgaagttatcaacgacttttcc
ggcggtgcccctgccaataccgatccgcgttttggggaaacgacgggtttaatcaacgat
actcaactgtttgaaaacggcttgcaggcgttccaagaatacaaccctatccgcgatgaa
ttttatgggcaaacgggagaggaacgcacctcagaagaacgcaaactctatcgctataac
acttatggcagcgatgccgccgttatcgttctggataatcgttctttccgcgatgcgcct
ctagaggaggctaatctgttagattcggaagatgtgacgcgattcctgagagaatctctg
actcgcgatcgcaccatgttgggggcaccgcagcttgccgatttgaagcgggatttacta
gcagccgaaaacaacggcatcacctggaaattcgttatggtgccggaaccgatccaaaac
tttggtcctgccttggcagcagatcgcttcgagggatacgctcaagagcgatcggaaatt
ctccgcttcattcaagaaaacaacatcgataacgtcgtttttgtcgcggctgatattcac
ggtaccgttgtcaacaatcttacttatcaagaagctcctggggaggaacaaattgctact
ggcgcttttgaaatttccacggggtcggttgcctttaatccgcctctcggtttcgttttg
gcagacataactactgccatcgaccccgaagccagggcgctttacgactccctacccgtt
gccaacgacccagacagcaccgttaatgacaaagacgatttcatcaagcagataatcaac
gaacaactacagcccctcggttacgatccgattgggttgaatgataatcttcccaacgct
gatggtttaataaatgcgacgctgttgcaaggagattatgttgctgcccacacctttggc
tggacggagttcgatgtcgatccccaaacccaacaactaaaagtcacaacctacggcatc
gaaccctactcagaggcagaattactcgtcaatccttctgaaattacaagtcgaacccca
accattgtcagcgaatttgtcgttaaccccgtcatcgattcaggtgcatctgcacccgaa
ccacaaactatctatggaaccctcaacgatgacacatttaatgcagcgatcgcgcttact
cccgaatcactcttaggcacgagtttctag

DBGET integrated database retrieval system