KEGG   Pleurocapsa sp. PCC 7327: Ple7327_3852Help
Entry
Ple7327_3852      CDS       T02367                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:plp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4098795..4099451
Genome map
AA seq 218 aa AA seqDB search
MTLSKSEPTAIKSTKSSFPNLTTEHQSLVSEEDMIQAVRTLLLGLGEDPDREGLKDTPKR
VVKALQFLTSGYHQSLDELLNGAVFHEDTDEMVLVRDIDLFSSCEHHILPILGRAHVAYI
PDGKVMGLSKIARICEMYARRLQVQERLTAQIADAIQGLLKPKGVAVVIEATHMCMVMRG
VQKPGSWTSTSAVRGVFAEDAKTRQEFMSLICHNPTFH
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccttatctaagtccgaacctactgcaatcaaatcgactaaaagttccttccccaat
ctgactaccgaacatcaatctcttgtttcagaagaggatatgatccaggcggtacggact
ttactgttaggattaggagaagatccagatcgcgaagggttaaaagatactcccaaacga
gtcgttaaagccttacaattcctgacgtcagggtatcatcaatctctcgatgaattgctt
aacggagcagtttttcatgaagataccgacgagatggtattggtgcgagatatcgatctt
ttcagttcctgcgaacatcatatcctacccattttaggtcgcgctcacgtcgcctatatt
cctgatggaaaagtaatgggactctcaaaaatcgcgcgcatttgtgaaatgtatgccaga
cgcttgcaagtgcaagaaagattaaccgcacaaattgccgatgccatacaaggattatta
aaaccaaaaggcgtggcggttgttatcgaagcaactcatatgtgtatggtgatgcgggga
gtacaaaaacccggttcttggacttctaccagtgccgtgaggggagtctttgcagaagat
gcgaaaactcgtcaagaatttatgagtttaatttgtcataatcctacctttcattaa

DBGET integrated database retrieval system