KEGG   Pleurocapsa sp. PCC 7327: Ple7327_4001Help
Entry
Ple7327_4001      CDS       T02367                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
plp  Pleurocapsa sp. PCC 7327
Brite
Enzymes [BR:plp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Ple7327_4001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4265261..4266301)
Genome map
AA seq 346 aa AA seqDB search
MKFLRIDRRIRRRFNLVALILLAILVALIWRHFLSSESVNLRATKPVEIAQTNEPIQPIP
IAIAIDSAKVALGEKLFQDVRLSQNNRVSCVSCHNLSQGGAARRSHSPGIDGAKTKVNTP
TVFNVRFNFRFNWDGEFERLFDHLDALMTNPKVMDTQWQKAIESFQNTPEYARSFNQIYP
DGVTQTNIKDAIVAYELSLNTPNSRFDRFLSGNKQALTAAEQEGYRLFKAYGCVSCHQGV
NVGGNMFQPFGAIGNYFADRGNITKADYGRYNITKNEADRYVFRVPSLRNVALTPPYFHD
GSAETLEGAIAIMTKYQLGRPLSQEQIDLIAQFLRTLNGVYQGKAL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcttgaggatcgatcggcgaattcggcgaaggtttaacttagttgctttaatt
ctactcgcaattctggttgcgcttatctggcgacatttcctatcttcagagtcagtcaat
ctgagggcaaccaaaccagtagagatcgctcaaactaacgaaccaatccaaccaattcca
atcgcgatcgcgattgacagcgctaaagtcgcattaggagagaaattatttcaggacgtg
cgtctttctcaaaataatcgggtatcttgtgttagctgtcataatcttagccaaggtgga
gccgctcgccgctctcattcgcctggaattgatggtgctaaaacgaaagtgaataccccg
accgtttttaatgtccgtttcaactttcgatttaattgggatggagaattcgagcgtctt
ttcgatcatctcgatgcgctgatgaccaacccaaaggtgatggatacccaatggcaaaaa
gccattgaatcgttccaaaatacgccagaatacgcgcggtcgtttaaccaaatttatccc
gatggcgtgacgcaaactaatattaaagatgcgatcgtcgcttacgaattatcccttaac
acgcccaactctcgtttcgatcgctttttgagtggcaataaacaggcgctaaccgcagca
gaacaagaaggttatcgactttttaaagcctatggctgcgtaagctgtcatcaaggggta
aatgttggggggaatatgtttcaaccctttggcgcgatcggaaactattttgccgatcgc
ggtaacataactaaagccgactacggacgttataacattaccaaaaatgaagccgatcgc
tacgtgtttcgagttcctagcttgcggaacgttgctttaactccgccttactttcacgat
gggtctgccgaaaccttagaaggggcgatcgcaattatgaccaaatatcaactcggtcgc
ccgctttcccaagaacagatcgatctcatcgctcagttcttacgcacccttaacggagta
tatcaaggtaaagcgctatga

DBGET integrated database retrieval system