KEGG   Pleurocapsa sp. PCC 7327: Ple7327_4002Help
Entry
Ple7327_4002      CDS       T02367                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:plp01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:plp00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4266508..4267812)
Genome map
AA seq 434 aa AA seqDB search
MLRIITGQAEARTELRRISDRARDDEIRSKEALVREILETVRLQGDRAILDYADKLEQRP
LELQRLRLSGSVLDAAYQQIPKELLDAIKLACRQLEEFYRQRVPKSWVQFREDDVAWGKR
YLPVQRAGLYVPGGTTPSLSTVLMQAIPAKAINVEQIVMVTPPDAQQRIDPRILVAAQEA
GVTEIYCIGGAAAIAALAFGTETIPKVEVITGPGDIYVTLAKKMVYGTVGIDFPAGVSDL
MIIADSEANPIQVAADLLAQAEQDTSAAAILLTPDAQLAEIVQEQVSQQLQHHPQRIFAE
KAIAHYGFIAIVDSLEEAVELANHFAPQYLALQVSDPWELSKQIRHAGAIFLGNSTPKVV
GDYLGGSSAILPTSGTARYASTVGVETFMKQANMIEYSPAALKKISSALQILAQTEGLPA
AADSIRLRILDFGF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatcattaccgggcaagccgaagcacgaacagaactgcggagaatcagcgat
cgcgctcgcgacgacgagattcgctccaaagaggcgttggttagagaaatcctcgaaacc
gtgagattgcaaggcgatcgagcgattttagactatgctgacaagttggagcagcgtccg
ctggaattgcagcgattgcgcttaagcggctcggtactcgatgctgcctatcaacaaatt
cccaaagaattgctcgatgccattaagttggcttgtcgccaactcgaagaattttatcgc
cagcgagtccccaaatcctgggtgcaatttcgcgaggacgacgttgcctggggcaagcgc
tatctacctgtccaacgagcgggactctacgtaccaggaggcacgactccatctctgagt
accgttctaatgcaagcgatccccgccaaggcaattaacgtggaacagattgtcatggtt
acgccgccagacgctcaacagagaatcgatccgagaattttagtagccgctcaagaagcg
ggagtgacggagatttattgcattggcggcgctgctgcgatcgcggctttggcgtttggc
acggaaaccatccctaaggtagaagtcattaccggaccgggagatatttacgtcacgctg
gcgaagaaaatggtctatggaacggtggggatcgactttcccgcaggcgtatcggattta
atgattattgccgacagcgaagctaaccccatccaagtcgccgccgatctcttagcacaa
gccgaacaggatacctcggctgccgccattctgctaacgcccgatgctcaattagctgaa
atcgtccaggagcaagtcagccaacaactgcaacaccatccccaacggatttttgccgaa
aaagcgatcgctcactatggatttatcgcgatcgtcgatagcttagaggaagccgtcgaa
ctcgccaaccattttgcacctcagtatctcgccctacaagtcagcgatccctgggaatta
tcgaagcaaattcgccatgctggagccattttcttaggcaactccactccaaaagtagtg
ggcgattatctgggcggttcttctgccattcttcccacctctggaacggctcgctatgcg
tctacggtaggagttgaaacgtttatgaagcaggcgaatatgatcgaatactctcccgct
gcgctcaaaaaaatctctagcgccttgcaaattctcgcccaaaccgaaggattgcccgct
gctgccgactcgattcgactgcggattctggattttgggttttag

DBGET integrated database retrieval system