KEGG   Pleurocapsa sp. PCC 7327: Ple7327_4013Help
Entry
Ple7327_4013      CDS       T02367                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ple7327_4013
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ple7327_4013
Enzymes [BR:plp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Ple7327_4013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4283965..4285458)
Genome map
AA seq 497 aa AA seqDB search
MSQLSQRQLTFEQLVPHAPKGRFDGIERNYTPEDVQKLRGSISICYTLAEMGANRLWELL
HSEDYINALGAVTGNQAMQMVRAGLKAIYLSGWQVAADANVAGAMYPDQSLYPANSGPEL
CRRINRTFQRADQIQHLEGKGNIHWFAPIVADAEAGFGGPLNSFEIMKAYIEAGAAAVHY
EDQLASEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGVPTLVVARTDAESATLITSDV
DERDRPFITGERTVEGFYRLKPGSGLAHCIARGLSYAPYADLLWWETSTPNLEEARLFAE
AIHSKYPGKLLAYNCSPSFNWKANLDESTIAKFQKELGAMGYKFQFVTLAGFHALNYSMF
ELARGYAQSGMAAYSQMQEAEFASEVHGYTATRHQREVGTGYFDAVSMAISGGQSSTTAM
AASTEAKQFYTDDEYNSSRVTIDYSNERETYHAELVNSVYRHLVDTEALEEIKEAHYARL
KQAYRELEEFARLDDDD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacttagccaacgccaactaacctttgaacaactcgttccccatgcccctaaa
ggtcgcttcgacgggatcgagcgcaattatacccccgaagacgtacagaaactacgcggc
tcgatttccatttgctacaccttagctgaaatgggagccaatcggctttgggaactcctg
cacagcgaagactacatcaacgcgctgggcgcagtgacgggaaatcaggctatgcaaatg
gtacgtgccggactcaaggcaatctacctatctggctggcaagtagcagccgacgctaac
gtcgccggagccatgtatcccgaccaaagcctctacccggctaatagcggtccggaattg
tgccgtcgcatcaaccgaacttttcagcgagccgatcaaattcaacacctggagggaaaa
ggcaatatccactggtttgcgcccatcgtcgccgacgcagaagctggatttggcggtccc
ttaaacagctttgaaatcatgaaagcctatatcgaggctggtgctgctgccgtacactat
gaagatcaactcgcttctgaaaagaaatgcggtcatctcggcgggaaagttctaattccc
acagccgcccacattcgcaacctcaacgccgcacggctggcggcagacgtgatgggagtc
cctacgctagtcgttgctcgcaccgatgcagaaagtgccacgctaattaccagcgatgtg
gacgagcgcgatcgcccctttattacgggagaaagaacggttgaaggattctatcgcctc
aaacccggttccggtcttgctcactgcattgctcgcggcttgtcttatgccccctatgcc
gacttgctatggtgggaaacctctacgccgaatttggaagaagcccgcctgtttgcagaa
gcgattcacagcaagtatcctggcaagctgctggcttataactgctctccctcgtttaac
tggaaagccaacctagacgagtccaccattgccaagttccaaaaagaactcggagcaatg
ggatataaattccaatttgtcaccctagctgggttccacgctctcaactacagcatgttt
gagttggctcgcggttatgctcaaagcggcatggctgcctactcccaaatgcaggaagcc
gaatttgctagcgaggttcacggctatacggcaacgcgccaccagcgcgaagtcggcacc
ggatattttgatgccgtctccatggcgatttctggcggacaatcgtcaacaactgctatg
gctgcgtctaccgaagcgaagcagttctataccgacgatgaatataatagctctcgcgtg
acgattgactacagtaacgaacgcgaaacctatcatgcggaattagttaattcggtgtat
cgccacctcgtcgatacagaagcgcttgaggaaattaaagaagctcactatgctcgcctc
aagcaagcttatcgagaattagaagaattcgctcgccttgacgacgacgactag

DBGET integrated database retrieval system