KEGG   Pleurocapsa sp. PCC 7327: Ple7327_4014Help
Entry
Ple7327_4014      CDS       T02367                                 

Definition
(RefSeq) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ple7327_4014
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ple7327_4014
   00630 Glyoxylate and dicarboxylate metabolism
    Ple7327_4014
Enzymes [BR:plp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ple7327_4014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4285563..4287194)
Genome map
AA seq 543 aa AA seqDB search
MTFTAPVQKDNQIVNGVNLLGKVSAEYAEILTKEALEFIAMLQRRFGAEREQLLKLREYA
QQQFDAGILPDFPAETEAIRNGDWKIAPIPQDLLDRRVEITGPTDRKMVINALNSGANAF
MADFEDSNSPTWDNMVSGQINLRDAVNRTIGFTDSKTGKEYKLNEKTAVLIVRPRGWHLL
ESHVLVDGRPMSGSLFDFGLYFFHNACKLIENGTGPYFYLPKLENRYEAALWNQVFVAAQ
EALGLPIGTIKATVLLETILASFEMDEILYELRDHIVGLNCGRWDYIFSFIKKFRNRPDF
VLPDRNEVTMTCHFMRSYSRLVIKTCHRRGAFAMGGMAAQIPIKNDPAANEAAFAKVRAD
KEREVGDGHDGTWVAHPALVPIAREVFDRQMTGPNQLSVLLNDITITAEDLLAIPRGKIT
EGGLRNNIRVGILYLTAWLAGNGCVPLYNLMEDAATAEICRAQVWQWLRHQAKLEDGRTV
DRALFQTILEEEIAALRREIADRSSWTATFDRATELFTELVTSERFEEFLTLPAYRHLVT
FSN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgacatttaccgctcccgtacagaaagataatcaaatagtcaatggagtaaatcttctc
ggcaaagtatcggcagaatatgctgaaattttgacaaaagaggcgctagagtttatcgct
atgttgcaacgccgttttggtgccgaacgcgagcaattgctcaaacttagagaatatgct
cagcagcaatttgatgctggcatactgccggactttcccgccgaaaccgaagcgatccgc
aacggcgactggaaaattgcgccaattccccaagatttactagaccgtcgcgttgaaatc
accggaccgaccgatcgcaagatggtcattaatgccctcaactcaggggctaatgccttt
atggctgatttcgaggattccaacagtccgacctgggacaatatggtatccgggcaaatt
aatttgcgcgatgccgtcaaccgaaccattggctttaccgattctaaaactggaaaagaa
tacaagctcaacgaaaaaactgccgttttgatcgttcgaccccgtggctggcatctgcta
gaatcacacgttctagtagacggtcgtcccatgtcgggttcgctattcgactttgggctt
tatttctttcacaatgcctgcaagctaatcgaaaacggcactggtccctatttttacctg
cccaagctggaaaataggtacgaagcggctttgtggaaccaagtttttgtagcggctcag
gaagcgcttggattgccgattgggactatcaaggcgactgtcctccttgaaaccattctc
gcttcttttgagatggacgaaattctatacgaactgcgcgatcatatcgtcggtctcaat
tgcggtcgctgggactacattttcagctttatcaaaaagtttcgcaatcgccccgatttc
gtcttgcccgatcgcaatgaagtgaccatgacgtgtcatttcatgcgctcttacagccga
ctggtaatcaaaacctgccatcgtcgcggtgcttttgccatgggcggaatggcagctcag
atcccgatcaaaaacgaccccgcagctaacgaagctgcctttgccaaggtacgcgccgat
aaagagcgggaagtcggcgacggtcacgacggcacgtgggtagcacaccccgcgctcgtt
cccatcgcacgcgaggtgtttgacagacaaatgacgggtccaaatcaactgtctgttctc
ctgaatgatatcaccattacggcagaggatctgctcgccatcccaagggggaaaattact
gaaggcggtcttcgcaataacattcgcgtcgggattttatacctaacggcttggctggct
ggaaatggttgtgtgcctctgtataacctgatggaagacgcagctacggctgaaatctgt
cgcgcccaggtttggcaatggctgcgccaccaggcaaaattagaggacggtcgcactgtc
gatcgcgccctcttccaaaccattttggaagaagaaattgcggcactgcgtcgagaaatt
gccgatcgcagcagttggacggctactttcgatcgcgccacagagcttttcacagagctg
gtaacttccgagcgctttgaagagttcttaacgctacctgcctatcggcacctcgttact
ttttctaactag

DBGET integrated database retrieval system