KEGG   Pleurocapsa sp. PCC 7327: Ple7327_4014Help
Entry
Ple7327_4014      CDS       T02367                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ple7327_4014
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ple7327_4014
   00630 Glyoxylate and dicarboxylate metabolism
    Ple7327_4014
Enzymes [BR:plp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ple7327_4014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4285563..4287194)
Genome map
AA seq 543 aa AA seqDB search
MTFTAPVQKDNQIVNGVNLLGKVSAEYAEILTKEALEFIAMLQRRFGAEREQLLKLREYA
QQQFDAGILPDFPAETEAIRNGDWKIAPIPQDLLDRRVEITGPTDRKMVINALNSGANAF
MADFEDSNSPTWDNMVSGQINLRDAVNRTIGFTDSKTGKEYKLNEKTAVLIVRPRGWHLL
ESHVLVDGRPMSGSLFDFGLYFFHNACKLIENGTGPYFYLPKLENRYEAALWNQVFVAAQ
EALGLPIGTIKATVLLETILASFEMDEILYELRDHIVGLNCGRWDYIFSFIKKFRNRPDF
VLPDRNEVTMTCHFMRSYSRLVIKTCHRRGAFAMGGMAAQIPIKNDPAANEAAFAKVRAD
KEREVGDGHDGTWVAHPALVPIAREVFDRQMTGPNQLSVLLNDITITAEDLLAIPRGKIT
EGGLRNNIRVGILYLTAWLAGNGCVPLYNLMEDAATAEICRAQVWQWLRHQAKLEDGRTV
DRALFQTILEEEIAALRREIADRSSWTATFDRATELFTELVTSERFEEFLTLPAYRHLVT
FSN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgacatttaccgctcccgtacagaaagataatcaaatagtcaatggagtaaatcttctc
ggcaaagtatcggcagaatatgctgaaattttgacaaaagaggcgctagagtttatcgct
atgttgcaacgccgttttggtgccgaacgcgagcaattgctcaaacttagagaatatgct
cagcagcaatttgatgctggcatactgccggactttcccgccgaaaccgaagcgatccgc
aacggcgactggaaaattgcgccaattccccaagatttactagaccgtcgcgttgaaatc
accggaccgaccgatcgcaagatggtcattaatgccctcaactcaggggctaatgccttt
atggctgatttcgaggattccaacagtccgacctgggacaatatggtatccgggcaaatt
aatttgcgcgatgccgtcaaccgaaccattggctttaccgattctaaaactggaaaagaa
tacaagctcaacgaaaaaactgccgttttgatcgttcgaccccgtggctggcatctgcta
gaatcacacgttctagtagacggtcgtcccatgtcgggttcgctattcgactttgggctt
tatttctttcacaatgcctgcaagctaatcgaaaacggcactggtccctatttttacctg
cccaagctggaaaataggtacgaagcggctttgtggaaccaagtttttgtagcggctcag
gaagcgcttggattgccgattgggactatcaaggcgactgtcctccttgaaaccattctc
gcttcttttgagatggacgaaattctatacgaactgcgcgatcatatcgtcggtctcaat
tgcggtcgctgggactacattttcagctttatcaaaaagtttcgcaatcgccccgatttc
gtcttgcccgatcgcaatgaagtgaccatgacgtgtcatttcatgcgctcttacagccga
ctggtaatcaaaacctgccatcgtcgcggtgcttttgccatgggcggaatggcagctcag
atcccgatcaaaaacgaccccgcagctaacgaagctgcctttgccaaggtacgcgccgat
aaagagcgggaagtcggcgacggtcacgacggcacgtgggtagcacaccccgcgctcgtt
cccatcgcacgcgaggtgtttgacagacaaatgacgggtccaaatcaactgtctgttctc
ctgaatgatatcaccattacggcagaggatctgctcgccatcccaagggggaaaattact
gaaggcggtcttcgcaataacattcgcgtcgggattttatacctaacggcttggctggct
ggaaatggttgtgtgcctctgtataacctgatggaagacgcagctacggctgaaatctgt
cgcgcccaggtttggcaatggctgcgccaccaggcaaaattagaggacggtcgcactgtc
gatcgcgccctcttccaaaccattttggaagaagaaattgcggcactgcgtcgagaaatt
gccgatcgcagcagttggacggctactttcgatcgcgccacagagcttttcacagagctg
gtaacttccgagcgctttgaagagttcttaacgctacctgcctatcggcacctcgttact
ttttctaactag

DBGET integrated database retrieval system