KEGG   Pleurocapsa sp. PCC 7327: Ple7327_4366Help
Entry
Ple7327_4366      CDS       T02367                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:plp00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Ple7327_4366
Enzymes [BR:plp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Ple7327_4366
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Ple7327_4366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4670336..4671184
Genome map
AA seq 282 aa AA seqDB search
MPELPEVETVCRDLNQLTQKQVIWGGEVLLKRTLAYPLSTSEFCQNIVGTKIACWQRRGK
YLLAQLTNASSESAGWLGIHLRMTGQLLWLERDRPLQKHVRIRLFMEGDRELRFVDTRTF
GKIWWVPPKESPERIITGLKKLGVEPLSPDFSWQYLQQKLQNSCRPIKIFLLDQKIIAGI
GNIYADEALFKSQIRPTAIARDLTPEQIERLRLAIIEVLQTAIDKGGTTFSNFRNVKGIN
GNYGGVAWVYGRGNQPCRLCATAIARVKLGGRSTHFCPQCQQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaactgcccgaagtagaaaccgtctgtcgggatctcaatcaactgacccaaaag
caagttatttggggtggggaagtattactcaagcgtactcttgcctaccctctttctacg
tcggaattttgccaaaacattgtaggaactaagatcgcttgctggcagcgacgcggtaaa
tatttgttggctcaactgacgaacgcttcatcagaaagtgctggttggttgggcattcac
ctgcgcatgaccggtcaactgttgtggttggagcgcgatcgccctttgcaaaaacacgtg
cgcattcgcctgtttatggaaggcgatcgcgagttgcgttttgtcgatacgcggacgttc
ggtaagatttggtgggtgccgccaaaagagtcgccagaaaggattattacgggtttgaaa
aaattgggtgtcgaaccgctttctcccgatttttcttggcaatacctccaacaaaagctg
caaaatagctgtcgtccgattaaaatctttttgctcgatcagaaaattatcgcaggcatt
ggcaatatttatgccgacgaagctttgtttaaaagtcagattagaccaactgcgatcgca
cgagatctaaccccagaacaaatcgaacgcttgcgactggcaattattgaagttttgcaa
acagctattgacaaaggcggcacgacctttagcaattttcgaaatgtcaagggaattaat
ggcaactatggcggcgtcgcttgggtttatggtcgtggcaaccaaccttgtcgtctctgc
gcaactgcgatcgcgcgagtgaaattaggcggtcgttctactcatttttgtcctcaatgt
caacagtag

DBGET integrated database retrieval system