KEGG   Pleurocapsa sp. PCC 7327: Ple7327_4402Help
Entry
Ple7327_4402      CDS       T02367                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ple7327_4402
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ple7327_4402
  Lipid metabolism
   00071 Fatty acid degradation
    Ple7327_4402
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ple7327_4402
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ple7327_4402
   00626 Naphthalene degradation
    Ple7327_4402
Enzymes [BR:plp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ple7327_4402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4711826..4712818)
Genome map
AA seq 330 aa AA seqDB search
MHAMILDVPGKPLRLADIPIPTPNPEQVLLRVRACGVCRTDLHVVDGELTHPKLPLVLGH
QIVGIVEKIGAKVTKFKQGDRVGVPWLGSTCNHCRYCLSGRENLCDRAQFTGYQLDGGYA
EYTVADEHFCFPIPQCYPDLQAAPLLCAGLIGYRSYRMAGDAERLGFYGFGAAAHILIQV
ARYQGREVYAFTRPDDVKGQQFALDLGAVWAGSSDELPPKELDAAIIFAPAGKLVPAALR
AIAKGGTVVCAGIHMSDIPSFPYSILWEERMVRSVANLTRLDGEEFLTLAPQIPIHTEVT
PFPLSAANEALEALRSGKINGAAVLVVDEN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcaatgattttggatgtgcctggtaaacccttacgtctggcagatatccccatt
cctactcccaaccccgaacaagttctactgcgggttcgtgcctgcggagtatgccggact
gacttgcacgtcgtcgatggagaactgactcatcccaaacttcccctcgtcttgggtcat
caaatcgtcggtatcgttgagaaaattggcgcgaaagtgacaaaatttaagcagggcgat
cgcgttggcgttccttggcttggctctacctgtaaccattgccgctactgtttgtcggga
agggaaaatttgtgcgatcgcgctcaatttacaggctatcaactcgatggcggttatgca
gaatatactgtcgccgacgaacatttttgcttccccattccccaatgctatcccgattta
caagcggcaccgcttctgtgtgccggactgatcggctatcgttcctatcgcatggcggga
gatgcagaacggctgggattctatggctttggtgcggcagcgcatattttaattcaagtt
gctcgctatcagggacgcgaagtctatgcctttactcgtcccgacgatgtcaaaggacaa
cagtttgccctcgatttaggggcagtctgggcgggaagttccgatgaattgccgccaaaa
gaattggatgcggcgattatttttgcacctgcgggcaagttggttcctgctgctttgaga
gcgattgccaaaggaggcacggtcgtctgtgcggggatccacatgagcgatattccttct
tttccctatagtattctctgggaagagagaatggtgcgatcggttgccaatctaacccgt
ctcgatggagaggaatttttgactttagcgcctcagattcccatccacacggaggttacg
ccttttccgctatcggctgcaaatgaagccctagaagctttacgaagtggcaagattaat
ggtgcagccgtgttagtggtcgatgagaattaa

DBGET integrated database retrieval system