KEGG   Pleurocapsa sp. PCC 7327: Ple7327_4670Help
Entry
Ple7327_4670      CDS       T02367                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:plp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:plp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:plp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:plp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:plp00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:plp00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4985242..4986147)
Genome map
AA seq 301 aa AA seqDB search
MDNLEVIGIDLGGTAIKLGRVLKDGTCREFITIATPQPAMPEAVVEAIIAALEQLNSERK
CIALGVGMPGPADAEGRIAKIAINLPGWYDVPLADWLEKETGLPTIIANDANCAGLGEAW
LGAGRRFRNMILLTLGTGVGGAVILDRKLFIGHRGAAGELGLITLNPDGPPCNSGNQGSL
EQYVSVRAIRRITGKEPAELGKLAKDGDKEALAFWEEYGRWLGAGLASSIYILSPEAVVI
GGGVSASAEFFFPATLAEIERRVMPTSRVGLELLTAQLGNQAGIIGAAKLAWQMLEGRAN
N
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggataatctcgaagttatcggtatcgatttaggcggaactgcgattaaactcggacgg
gttctcaaagatggaacttgtcgagagttcataaccattgctactccccaacctgccatg
ccagaagcggtagtagaagctattattgctgcactagagcaactcaatagtgagcggaaa
tgcattgctttgggggttggaatgcccggacctgctgatgctgagggaagaatcgcgaaa
atagcaattaatctcccagggtggtacgatgttcccctagccgattggttagaaaaagaa
acggggctgccaacgattattgctaacgatgccaattgtgctggactgggagaggcatgg
ttaggggcaggaaggcgatttcgcaatatgattctattaacactgggaacgggtgtaggc
ggcgccgtcatcctcgatcgcaagttgtttataggacaccgaggcgcagccggagaatta
ggattgattaccttaaatccagatggtccgccctgcaatagcggcaatcaaggatcttta
gagcaatacgtctcggttcgagctattcgtcgcatcacgggcaaagaacctgctgagtta
ggaaaattggctaaagacggcgacaaggaggcattggctttctgggaagaatatggaaga
tggttaggggcaggattggctagttcgatttatatcttgtcgccagaagcggtggttatt
ggcggcggagttagtgccagtgcagaatttttcttccctgcaactttagcagaaatagaa
cgaagagttatgccaacttcccgcgtcgggttagagctgttaaccgcacaattaggcaat
caagcaggcattataggggcagcaaagttggcttggcagatgctagaaggtagagcgaat
aactga

DBGET integrated database retrieval system