KEGG   Candidatus Portiera aleyrodidarum BT-QVLC: PAQ_123Help
Entry
PAQ_123           CDS       T02306                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
plr  Candidatus Portiera aleyrodidarum BT-QVLC
Pathway
plr00020  Citrate cycle (TCA cycle)
plr00310  Lysine degradation
plr01100  Metabolic pathways
plr01110  Biosynthesis of secondary metabolites
plr01120  Microbial metabolism in diverse environments
plr01130  Biosynthesis of antibiotics
plr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAQ_123 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PAQ_123 (sucB)
Enzymes [BR:plr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PAQ_123 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh DUF979
Motif
Other DBs
NCBI-ProteinID: AFS18849
Position
138414..139484
Genome map
AA seq 356 aa AA seqDB search
MLEVVSPTEGFLQIIKIPVGKKCKSEQLLGIIVAQKEEGFYSSGSSSTNIKQQKLCKKEQ
KVDESEKQELKQFYKQAIELEESYSPEVRKAKTSIDVENLFENGTVQDKRVNIRKENVKY
SINEIGVKRVQLSRLRQTITKRIVKAQKNAAMLTTYNEVDMGNILEIRTKYRELFEKKHG
TKLGLMGFFVKACTVALKQFKKVNAVIDDKEIVYHNYQDIGIAVFSNRGLVVPILRHTDS
IKIEEIEKKIMDFRKRGVDGKLSIKELTGGTFTISNGGVFGSLFSTPIINPPQTAILGMH
KIQNRPVVLKGEIVIRPMMYLALSYDHRLIDGKDAVNFLFFVKELLEQPIRFILNI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaggttgtttcaccaactgaagggtttcttcaaattataaagataccagtaggt
aaaaaatgcaaatccgagcaattgttaggtattattgtagcacaaaaagaagaaggtttt
tatagttcaggttcatcaagcacaaacatcaaacagcaaaaattgtgtaaaaaagagcaa
aaggtagatgaatcagaaaaacaagaattaaaacagttttataaacaagcaatagaatta
gaagaaagttattcaccagaggtacgtaaggctaagactagtatagatgttgaaaactta
tttgagaatggcacagtacaagataaaagggtaaatattagaaaagaaaatgttaaatat
agtattaatgaaattggagttaaaagagtacaattaagtcgtttacgtcagacgattact
aaacgtatcgtgaaagctcaaaaaaatgctgcaatgttaactacttataatgaagtagat
atgggtaatatattagaaatacgcacaaaatatcgagaactatttgaaaagaaacatgga
actaagctagggttaatgggattttttgtaaaagcttgtacggtggcgctaaaacagttc
aaaaaagtaaatgcagttattgatgataaagaaattgtttatcataattatcaagacata
ggaatagcagtcttttcaaataggggtttagttgttcctattttaaggcatactgattct
ataaaaatagaagaaatagaaaaaaaaattatggattttaggaaacgtggtgttgatgga
aaattaagtattaaagaattaactggtggaacttttacgataagtaatggaggagttttt
ggatctctgttttctactcctattattaatccccctcaaactgctattttgggaatgcat
aaaattcaaaaccgtcctgtagttttaaaaggagaaatagttatacggcctatgatgtat
ttagccttgtcgtatgatcatcgtcttattgatggaaaagatgcagttaattttttattt
tttgttaaggagcttttagaacaacccattcgttttatattaaacatttaa

DBGET integrated database retrieval system