KEGG   Candidatus Portiera aleyrodidarum BT-QVLC: PAQ_123Help
Entry
PAQ_123           CDS       T02306                                 

Gene name
sucB
Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
plr  Candidatus Portiera aleyrodidarum BT-QVLC
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:plr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:plr00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:plr00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
138414..139484
Genome map
AA seq 356 aa AA seqDB search
MLEVVSPTEGFLQIIKIPVGKKCKSEQLLGIIVAQKEEGFYSSGSSSTNIKQQKLCKKEQ
KVDESEKQELKQFYKQAIELEESYSPEVRKAKTSIDVENLFENGTVQDKRVNIRKENVKY
SINEIGVKRVQLSRLRQTITKRIVKAQKNAAMLTTYNEVDMGNILEIRTKYRELFEKKHG
TKLGLMGFFVKACTVALKQFKKVNAVIDDKEIVYHNYQDIGIAVFSNRGLVVPILRHTDS
IKIEEIEKKIMDFRKRGVDGKLSIKELTGGTFTISNGGVFGSLFSTPIINPPQTAILGMH
KIQNRPVVLKGEIVIRPMMYLALSYDHRLIDGKDAVNFLFFVKELLEQPIRFILNI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaggttgtttcaccaactgaagggtttcttcaaattataaagataccagtaggt
aaaaaatgcaaatccgagcaattgttaggtattattgtagcacaaaaagaagaaggtttt
tatagttcaggttcatcaagcacaaacatcaaacagcaaaaattgtgtaaaaaagagcaa
aaggtagatgaatcagaaaaacaagaattaaaacagttttataaacaagcaatagaatta
gaagaaagttattcaccagaggtacgtaaggctaagactagtatagatgttgaaaactta
tttgagaatggcacagtacaagataaaagggtaaatattagaaaagaaaatgttaaatat
agtattaatgaaattggagttaaaagagtacaattaagtcgtttacgtcagacgattact
aaacgtatcgtgaaagctcaaaaaaatgctgcaatgttaactacttataatgaagtagat
atgggtaatatattagaaatacgcacaaaatatcgagaactatttgaaaagaaacatgga
actaagctagggttaatgggattttttgtaaaagcttgtacggtggcgctaaaacagttc
aaaaaagtaaatgcagttattgatgataaagaaattgtttatcataattatcaagacata
ggaatagcagtcttttcaaataggggtttagttgttcctattttaaggcatactgattct
ataaaaatagaagaaatagaaaaaaaaattatggattttaggaaacgtggtgttgatgga
aaattaagtattaaagaattaactggtggaacttttacgataagtaatggaggagttttt
ggatctctgttttctactcctattattaatccccctcaaactgctattttgggaatgcat
aaaattcaaaaccgtcctgtagttttaaaaggagaaatagttatacggcctatgatgtat
ttagccttgtcgtatgatcatcgtcttattgatggaaaagatgcagttaattttttattt
tttgttaaggagcttttagaacaacccattcgttttatattaaacatttaa

DBGET integrated database retrieval system