KEGG   Candidatus Portiera aleyrodidarum BT-QVLC: PAQ_149Help
Entry
PAQ_149           CDS       T02306                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
plr  Candidatus Portiera aleyrodidarum BT-QVLC
Pathway
plr00010  Glycolysis / Gluconeogenesis
plr00020  Citrate cycle (TCA cycle)
plr00620  Pyruvate metabolism
plr01100  Metabolic pathways
plr01110  Biosynthesis of secondary metabolites
plr01120  Microbial metabolism in diverse environments
plr01130  Biosynthesis of antibiotics
plr01200  Carbon metabolism
Module
plr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:plr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAQ_149 (aceF)
   00020 Citrate cycle (TCA cycle)
    PAQ_149 (aceF)
   00620 Pyruvate metabolism
    PAQ_149 (aceF)
Enzymes [BR:plr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PAQ_149 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF1725
Motif
Other DBs
NCBI-ProteinID: AFS18871
Position
complement(165222..166334)
Genome map
AA seq 370 aa AA seqDB search
MIIKLPEIGDINKKVEVIEIPVKVGEFIKKDDTIVVLESEKATIDLPSPNEGTITKILIK
EGENIYSGKSIMELEDIINKKVILNKEKSIAQAGPAAKLMARKLGIDLETDKIIGSGKKN
CILKEDLKSYIKDKRIESSEDNTDQNVKNILSVSAKKLHNSWRNIPHVTHFDELDITKVE
KFRKTIKYELGIKITLLSFFIKVCSCALQKFSKFNMLLDLKTNKRNFHKSSHNNISIAIN
TSKGLLVPVIKHVDKKNIIDIALELKEITKRTLIGKNKLDDMMGGCFTISNLGIIGGKGF
TPIINSPEIGILGIGKTNIKPIWTGKQFKPTTMLPICLSYDHRFINGVYAAKFIKFIIKL
LTDIRNWIVC
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgataataaagctacctgaaataggtgatataaataaaaaagttgaagttatagaaata
cccgtaaaagtaggagaatttataaaaaaagatgacactatagttgttttagagtcagaa
aaagctactattgatttaccttcaccaaacgaaggaacaataactaaaattttaattaaa
gaaggtgaaaacatatattcgggtaagtcaataatggaattagaagacattataaacaaa
aaagttattttaaataaagaaaaaagtattgcacaggcgggtcctgctgcaaaattaatg
gcaagaaaattaggtattgatttagaaacagacaaaataatcggaagtggaaagaaaaat
tgtattttaaaagaagatttaaaaagttatataaaagataagagaatagagagttcagaa
gacaacactgatcaaaacgtaaagaatatattaagtgtaagtgctaaaaagttacataat
agttggagaaatatacctcatgtaactcattttgatgaattagatataacaaaagtagaa
aagtttagaaaaacaataaaatatgaattaggtattaaaataacattattatcttttttt
ataaaagtatgttcttgtgcattacaaaaattttctaagtttaatatgttgttggattta
aaaacaaataaacgtaattttcacaaatcaagccataataacattagcattgctataaat
acatcaaaaggtttgttagtgcccgtaataaaacatgttgataaaaaaaatatcattgat
attgctttagaattaaaagaaataactaaaagaacattaataggtaaaaataaactagat
gatatgatgggtggctgttttacaatatctaatttaggaataataggtggtaaaggtttt
actccaatcattaacagtccagaaataggaattttaggcattggcaaaacaaacattaaa
cctatttggactggtaaacaatttaaaccaacaacaatgttaccaatttgtctctcgtat
gatcatagatttataaatggcgtttatgcagcaaagtttattaaatttataattaagtta
ttaactgatattcgtaattggattgtttgttaa

DBGET integrated database retrieval system