KEGG   Candidatus Portiera aleyrodidarum BT-QVLC: PAQ_182Help
Entry
PAQ_182           CDS       T02306                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
plr  Candidatus Portiera aleyrodidarum BT-QVLC
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:plr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:plr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
216775..217929
Genome map
AA seq 384 aa AA seqDB search
MYYLLKLVLNLLSKNSITPNDKGCQYLLSNIFKRLCFRVEVFNKKGVHNLWVTNGFCKKT
LLFVGHTDVVPSGPIKAWEINPFLPYLNNRGYIISRGIVDMKGSLCSMIKATCNFIKLYP
KSKEKIAFLITSDEEGDGNYGTKYVINKLIKRNEIINYCIIGEPTSKSNTGDTLKIGRRG
SLNAKIIIYGIQGHIAYTKQLLNPIHILINIIHYLLKIRWDKGNKYFSKTSFQISNFIAG
LGVSNMLPKYAKVLCNFRFSNELTVNKIKTKVSNIFLLFNLNKKKDFKINWYLSGEPYLT
KKGTLLNAVIFGINYMCKIQPKKNTNGGISDGRFVKNLCKQIIELGLINATIHKINECVC
VSDIILLTKLYQLIIEYLFIYKLK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtattatcttttaaaactagtattaaatttactttcaaaaaactctattacacctaat
gacaaaggatgtcaatatttgcttagtaatatatttaaacgtttatgttttcgtgtagaa
gtttttaataaaaaaggagttcataatttatgggttacaaacggattttgtaaaaaaaca
ttgttatttgttggtcatacagatgtagttccttcaggcccaattaaagcatgggaaatt
aacccgtttttaccttatttaaataatagaggatatattatatcacgtggaattgtcgat
atgaaaggtagtttatgttcaatgataaaagcaacatgtaattttataaaattatatcca
aaatctaaagagaaaatagcttttttaataacaagtgatgaagaaggtgatggaaattat
ggtactaaatatgttataaataagttaataaaaagaaatgaaataataaattattgtatt
atcggtgagcctactagtaaatcaaatacaggtgatactcttaaaataggtagacgaggt
tcattaaatgccaaaataataatatacggtattcaaggacatatagcgtatacaaaacaa
ttgctaaatccaatacatatattaattaatataatacattatttattaaaaattagatgg
gataaaggtaataaatatttttctaaaaccagttttcaaatatccaacttcattgcagga
ttaggtgtaagtaatatgttacctaaatacgcaaaagtattatgtaattttagattttca
aatgaacttacagttaataaaattaaaaccaaagtaagtaacatatttttactgtttaat
ttaaacaaaaaaaaagattttaaaatcaattggtatctatctggagaaccatacctaaca
aaaaaaggtactttgttaaatgctgtaatttttggaattaattatatgtgcaaaatacaa
ccaaaaaaaaatacaaatggtggcatatcagatggtagatttgtcaaaaatctttgtaaa
caaataattgagttaggcttaataaatgccactatacataaaataaatgaatgtgtttgc
gtttctgatattatactattaacaaaactgtatcaacttatcattgaatatttgtttatt
tataaattaaaataa

DBGET integrated database retrieval system