KEGG   Candidatus Portiera aleyrodidarum BT-QVLC: PAQ_208Help
Entry
PAQ_208           CDS       T02306                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
plr  Candidatus Portiera aleyrodidarum BT-QVLC
Pathway
plr00010  Glycolysis / Gluconeogenesis
plr00520  Amino sugar and nucleotide sugar metabolism
plr01100  Metabolic pathways
plr01110  Biosynthesis of secondary metabolites
plr01120  Microbial metabolism in diverse environments
plr01130  Biosynthesis of antibiotics
plr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAQ_208 (glk)
   00052 Galactose metabolism
    PAQ_208 (glk)
   00500 Starch and sucrose metabolism
    PAQ_208 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PAQ_208 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PAQ_208 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PAQ_208 (glk)
Enzymes [BR:plr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PAQ_208 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFS18923
Position
complement(254079..255050)
Genome map
AA seq 323 aa AA seqDB search
MNHLALVGDIGGTNVRLALALVSTNQLKLYKIKIFKCINYLNVYEVIKQYISLVGCDYPK
QACLAFACPVYSNFIKMTNNSWTIAKYELKHKLNLQKLKIINDFTAIALGLTHIQAKDLY
KLGYGKTNNNSNKILIGPGTGLGIAGLIHTKNSWIPFSGEGGHISFAPIDNFEVYILNWF
QNNYKRVSIERILCGQGIVDLYYAHVNYYINHSYNVLTTPDAITKAALKKNDPLAYKTIL
MFCKLLGHVTGDMALTLGAKGGVYLCGGILPRIIKILDNSDFRNSFDNKGRMSFYNKEIS
TWLVKSKWIGLLGSADALFNNKL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttagcattagtaggtgatataggcggaacgaatgttcgtttagctttagct
ttagtatcaacaaatcaattaaaattatataaaataaaaatatttaaatgtattaattat
ctaaatgtttatgaagttataaaacaatatatttctttagttggttgtgattatcctaaa
caagcttgtttagcgtttgcttgtcctgtttactctaattttataaaaatgacaaataat
tcttggacaatagcaaaatatgaattaaaacataaactgaacttacaaaagttaaaaata
atcaacgattttactgcgatagccttagggttgactcatattcaagcaaaagatttgtat
aaacttggatacggaaaaactaataataatagtaataaaattttaataggacctggaact
ggattaggaattgccggtttaattcatactaaaaattcatggatcccattttctggggaa
gggggtcatatcagttttgcgccaattgataactttgaagtatatattttaaattggttt
caaaataattataagcgtgtttctattgaacgcatactttgtggacaaggaatagtagat
ttatattatgcacatgttaattattatattaaccactcttataatgttttaacaacgcct
gatgccattacaaaagcagctttaaaaaaaaacgatcctttagcatataaaactattttg
atgttttgtaaactattaggtcatgtaacaggtgatatggcgttaactttaggagctaaa
ggaggagtgtatttatgtggaggaatattacctagaatcataaaaatcttagataatagt
gattttcgtaattcttttgacaataaaggaagaatgagtttttataataaagaaatttca
acttggttagttaaatctaaatggataggtttattagggtcagctgatgctttgtttaat
aacaaactttaa

DBGET integrated database retrieval system