KEGG   Candidatus Portiera aleyrodidarum BT-QVLC: PAQ_250Help
Entry
PAQ_250           CDS       T02306                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
plr  Candidatus Portiera aleyrodidarum BT-QVLC
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:plr01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:plr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
309723..310541
Genome map
AA seq 272 aa AA seqDB search
MKILFNILKYKRNTINVCINKLSLKILRKGFYSNKEQFSNNKFIKSIKNKQYKNQTSIIA
EIKRCSPSKGIITETKNIEKLALNYFLNGAVCISILTEKNFFKGSKKYILTVKKLFDIPI
LFKDFIIDEYQVFEARLLCTDCILLIVSILKLDLLKKLYNLALSIGLDVLLEIHNLLELE
VALFSLNAKFIGINNRNLYTFNTSINITISLLKYMPSNVVFVTESGILNVNDFIKLQRFG
VNVFLIGEFLLSNNDIFLRTLLDKANKYILTY
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattgtttaatattttaaaatataaacgtaatacaattaatgtttgtataaat
aaattatctttaaaaattttacgtaaagggttttattcaaataaagagcagttttctaat
aacaaatttattaaatccataaaaaacaaacaatataagaatcaaacttcaataattgca
gaaattaaacgatgttcaccttctaaaggaattattactgaaactaagaacattgaaaaa
ctagctttgaattattttttaaatggagctgtgtgtatttcaatattaacagaaaagaat
ttttttaaaggtagtaaaaaatatatattaactgtcaaaaaactttttgatatacctatt
ttgtttaaagattttattattgatgaatatcaagtttttgaagcacggttactatgtaca
gattgtattttgttaatagtttcaattttaaaacttgatttattaaaaaagttatataat
ttggccttatcaattggtttagatgtattacttgaaatacataaccttttagaattagaa
gtagcgttattttctttaaatgcaaaatttataggtatcaataatcgaaatttatataca
tttaatacatctattaacataaccatttcattattaaaatatatgccttcaaatgttgtt
tttgttacagaatctggaattttaaatgttaatgattttataaaattacaaaggtttggt
gttaatgtttttttaataggagagtttttattaagtaataatgatatctttttaagaact
ttacttgataaagctaataaatatatattaacatattaa

DBGET integrated database retrieval system