KEGG   Candidatus Portiera aleyrodidarum BT-QVLC: PAQ_290Help
Entry
PAQ_290           CDS       T02306                                 

Gene name
thrC
Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
plr  Candidatus Portiera aleyrodidarum BT-QVLC
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:plr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:plr00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
350736..352121
Genome map
AA seq 461 aa AA seqDB search
MRYVSTRGVAPVLSFEDTVLTGLASDGGLYVPEIIPKLSHKEFIELSKCSYIESAYRIMR
LFIDDVDDMSLKLLIKKSYTRFCNDSIVPIKQIGNNQFLLDLFTGPTFAFKDIALQFMGN
LIDYFLKKRGEKAVIMGATSGDTGSAAIAGFCDCNNLDMFILHPNKMVSEIQRRQMTTVK
QDNIHNIALKGNFDDAQAIVKDSFNNRGFIKGRRLIAINSINWARILAQTVYYIVSALAV
GAPFRNVSFTVPSANFGNIFAGYIAYKMGLPIRQLIIATNVNNILHRIIEYNDFSIRNLV
NTIAPAMDIVVSSNFERLLFYAYNKDSNAINNLIYNFNNKNYTILDEKPLKKLRTLFYST
SVNDNTILSILSQFYNRNGFIVDPHTAIGLIAAERCNNFPEIPMITLATAHPAKFYDTIL
KSGLFLKLPSLLNELLLKEEQYSILPADISKVHSYILSVCH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgttagtactcgcggtgttgctcctgtactttcatttgaagatacagtattg
actggtttagcaagtgatggtggtttatatgttccagaaataattcctaaactttcgcat
aaagaatttatcgaattaagtaagtgttcatatattgaatcagcatatcgtataatgcgt
ctttttattgatgatgttgatgatatgtccttaaaacttttaattaaaaaaagctataca
aggttttgtaatgattcaatagttccaataaaacaaataggtaacaatcaatttttattg
gacttgtttactggtcctacatttgcttttaaggatatagctttacaatttatgggtaat
ttaatagattattttttaaaaaaacgtggcgaaaaagctgttattatgggtgcaacgtca
ggagatacaggatcagctgctattgctggtttttgtgattgtaataatttagacatgttt
attttacacccaaataaaatggtatcagaaattcaaagaagacaaatgactacagttaaa
caagataatatacataatatagctttaaaaggaaattttgatgatgcgcaggcaatagtt
aaagatagttttaataatcgtggctttattaaaggaagaaggttaattgctataaactca
ataaattgggcacgtattttagcacaaacagtatattatattgtttcagcacttgcagta
ggtgctccttttaggaatgtaagttttaccgtaccgtcagcaaattttggaaatattttt
gcaggatatatagcttataaaatgggcttgccaattaggcaactaataattgcaacaaat
gttaataatatacttcatcgtattatagaatataatgatttttctataagaaatttagtt
aatactatagcgccagctatggatatagttgtttcttctaattttgaacggttgttgttt
tatgcttataataaagattcaaatgctattaacaatttgatttataactttaataataaa
aattacactatactagacgaaaaacctttgaagaaattaagaactttgttttatagtacg
agtgtaaatgataacactattttgtctatactaagtcagttttataaccgtaatggtttt
atagtagaccctcacacagctataggtttaattgctgccgaaagatgtaataattttcca
gaaatacccatgattacgttagctacagctcatccagctaaattttatgataccatttta
aaatctggactttttcttaaattaccttctttacttaacgaattattactaaaagaagaa
caatattctattttgcctgcagatatttcaaaagtgcacagttatatattaagtgtttgt
cattaa

DBGET integrated database retrieval system