KEGG   Chlorobium luteolum: Plut_0050Help
Entry
Plut_0050         CDS       T00291                                 

Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
plt  Chlorobium luteolum
Pathway
plt00860  Porphyrin and chlorophyll metabolism
plt01100  Metabolic pathways
plt01110  Biosynthesis of secondary metabolites
plt01120  Microbial metabolism in diverse environments
Module
plt_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Plut_0050
Enzymes [BR:plt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Plut_0050
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Plut_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: ABB22940
JGI: Plut_0050
UniProt: Q3B6U1
Position
53176..54579
Genome map
AA seq 467 aa AA seqDB search
MSPSKQPLKYPDMKKKDQQTKGYVYIIGAGPGDPDLLTLKAERALQASDVILYDDLVTSA
LVDRFEGLKIYTGKRKDSHHFEQDAINEEIVRHALRGKTVARLKGGDPFVFGRGGEEIDV
LRQHRIDYEIIPGITAAHGASSYSEIPLTMRKVSSSVAFCTGHPINKIQAPDADTLVYYM
VASSVHAVLEAVLKKGRSESTKVAIVQNATRYNQQVFTGTIGEFLRRDRVAYSPALLIIG
ENINHFIEENWYSRKKKVLTVGGEPAQFSSREYVRVNFPCRREEAAERSVLEECFHGIGD
WPVVFFPNRFAVKYFFGYLMEFGRDVRHLAGARICTLGRPAATELQKYGVLSDLVLEPES
PSAIAGMLRDGGICNDRVLLPGSNLVDSYLVNALEEEGNTVTPLSVYLHGKHEQEESIDL
DFIDEIWFSSPSCVKNFSALYRSIPENITVTTADVETAAEYARLFGS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccagcaagcaacctctgaagtaccccgatatgaaaaagaaagaccagcagacg
aagggatatgtctacatcatcggcgccggtcccggcgaccccgatctcctcaccctcaag
gccgaacgcgcactccaggcgtccgacgtgatcctctatgacgatctggtcacgagcgca
ctcgtcgatcggttcgaggggctgaagatctataccggcaagcgcaaggacagccaccac
ttcgagcaggacgccatcaacgaggagattgtccgccacgctctgcgcggcaagaccgtc
gcccgtcttaagggaggcgatccgtttgttttcgggcgcgggggcgaggagatcgacgtt
ctccgccagcaccgcatcgactatgagatcatccccggcatcacggccgcgcacggggcg
agttcctacagcgaaatcccgctcaccatgcggaaggtatcctcgtcggtcgcgttctgt
accggccatcccatcaacaagatccaggcgccagatgccgacacgctggtctactacatg
gtggcatcgtccgttcatgcagtgctcgaggccgttctgaaaaaagggcgaagcgagtca
acgaaggtggccatcgtccagaacgccacccgatacaaccagcaggtctttactggtacc
atcggtgagttcctgcggcgcgacagggttgcatattctcctgccctgctcatcatcggt
gagaacatcaaccacttcatagaggaaaactggtactcacgcaagaagaaggtgcttacg
gtcggcggcgagcccgcccaattcagcagtcgggaatatgtgcgggtcaacttcccctgc
cggagggaagaggctgccgagcgcagcgtgctcgaggagtgtttccatggcatcggcgac
tggccggtcgtgttcttcccgaaccgctttgccgtcaagtatttcttcggctacctgatg
gagttcggtcgcgacgtacgtcaccttgcgggcgcccgcatctgcaccctcggccgtccg
gcggccacggagcttcagaagtacggagtcctcagcgacctcgtacttgagcccgaaagc
ccgtcggccatcgccggcatgctgagggacgggggtatctgcaacgatcgggtgcttctt
cccggctcgaacctcgttgacagctacctcgtcaacgcccttgaggaagagggcaatacg
gtcactccgctgtcggtctacctgcacggcaagcatgagcaggaggagagcatcgacctg
gacttcatcgatgaaatctggttttcctcgccctcatgcgtgaaaaacttcagcgccctc
taccggagcatcccggagaacatcacggtgacgacggctgacgtggaaaccgcagcggaa
tacgcccgcctgtttggcagctga

DBGET integrated database retrieval system