KEGG   Chlorobium luteolum: Plut_0077Help
Entry
Plut_0077         CDS       T00291                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
plt  Chlorobium luteolum
Pathway
plt00900  Terpenoid backbone biosynthesis
plt01100  Metabolic pathways
plt01110  Biosynthesis of secondary metabolites
plt01130  Biosynthesis of antibiotics
Module
plt_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Plut_0077
Enzymes [BR:plt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Plut_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ABB22967
JGI: Plut_0077
UniProt: Q3B6R4
Position
complement(81413..82561)
Genome map
AA seq 382 aa AA seqDB search
MRALSILGSTGSIGLSTLDVVRQHPDRFKIVGLAEGHDVNMLAEQIREFNPSIVSVRDAG
SAELLKTLLGTDLPEICHGIEGAGTVAAAEGSDMVVSAIVGAAGLTPTVKAIKAGKDIAL
ANKETLVVAGQLVSDLVKKHNVRLLPVDSEHSAIFQSLQGHRQEDVERIILTASGGPFRN
SSFADMEKAGPEQALKHPQWSMGAKITIDSASMMNKGLEVIEAHWLFNMPAEKIGVVVHP
QSIIHSMVEYIDGCVIAQLGSPDMRAPIAYALSWPERCESGIKKLDLATIGTLTFEEPDM
VRFPALRLAFDALKAGRTYPAVLNAANEVAVAAFLNNKIGFTAIAETVDKTMQAHEAYTP
VELEEYINADGWARRAANAIIG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagagcattatcgattctcggcagcaccgggtccatcggactcagcacactcgatgtc
gtccgccagcaccccgatcgattcaagattgtcggcctggctgaaggccatgatgtcaac
atgctcgcagaacagatcagggagttcaacccctccatcgtatcggtacgtgatgccggg
tccgctgaactcctcaaaactctcctcggcaccgacctgcccgagatatgccacggcatc
gaaggcgccggaaccgttgctgccgccgagggctccgacatggtcgtctcggcaatcgtg
ggtgctgcaggactgacccccaccgtcaaggccatcaaggcgggaaaagatatcgcgctg
gcaaacaaggagaccctcgtcgtcgcaggacagctggtatccgatctcgtaaagaaacac
aacgtgcggctactgccggtcgacagcgaacattccgccatcttccagtcgcttcagggc
caccgtcaggaagacgtggagcgcatcatcctcaccgcttcgggcggacctttccgcaac
tcgtccttcgccgacatggagaaggccggccccgagcaggccctcaagcacccgcagtgg
agcatgggcgcaaaaatcaccatcgactcggcaagcatgatgaacaaagggcttgaagtg
atcgaggctcactggctcttcaacatgcccgccgaaaagatcggcgtggtagtccatccg
cagagcatcatccactctatggtcgagtacatcgacggctgcgtgatcgcccagctcggg
tcccccgacatgcgcgccccgattgcctacgccctttcctggccggaacggtgcgaaagc
ggcatcaagaaactcgatctggcaaccatcggcaccctcaccttcgaggaacccgatatg
gtccggttcccggcgctgcgtctcgccttcgatgccctcaaggcagggaggacttacccg
gcggtgctgaatgcggcaaacgaagtagcagtcgcggccttcctcaacaacaagatcggc
ttcaccgccatcgccgaaaccgttgacaaaaccatgcaggcgcatgaggcttacaccccc
gtagagctcgaggagtatatcaatgccgacggttgggcacgccgggcggcaaacgcaatc
atcggataa

DBGET integrated database retrieval system