KEGG   Pelodictyon luteolum: Plut_0225Help
Entry
Plut_0225         CDS       T00291                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
plt  Pelodictyon luteolum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plut_0225
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plut_0225
   00052 Galactose metabolism
    Plut_0225
   00500 Starch and sucrose metabolism
    Plut_0225
   00520 Amino sugar and nucleotide sugar metabolism
    Plut_0225
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Plut_0225
   00524 Butirosin and neomycin biosynthesis
    Plut_0225
Enzymes [BR:plt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Plut_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
222357..223346
Genome map
AA seq 329 aa AA seqDB search
MSQWAIGIDLGGTAVKAAVAGRTAGIITETTVPTEALQGSSGVLDLIAATAADLYRSASV
TLDPAEFRGIGLGAPGAVDCLRGTLSHPPNLPGWEVIELRRELQQRLHSGPGIDCEVFLD
NDANAAAYGEAVYGAGRAFPDFLMVTLGTGVGGGIVLNHKLYRGPNGTAGEVGFMIVDYN
GSSLHAGIRGTLEGLIGKDRLVEMARRMIAEHPSPSSVGALCGNDWASLSPRHLETAALE
GDLAAKDVWTRVGSILGTGLASVTALMDIRKFVVGGGISAAGDLLLKPALAALQRSTLPS
MHDGLSVVRAELGNRAGMHGAAALCFSGE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaatgggccatcggcatagatctcgggggcacagccgtcaaggccgcagttgcc
ggccggaccgccggcatcatcactgaaaccaccgtccccacagaagccctgcagggttcc
agcggtgtgctcgaccttattgctgcgacagcagcagacctctaccggagtgcatcggtc
acgctcgatcctgccgaattcaggggcatcggcctcggtgccccgggtgcagtggactgc
ctccggggcaccctcagccatccgcccaaccttcccggctgggaggtcatcgaactgagg
cgtgaactgcagcagcgcctccacagtggccccggtatcgactgtgaggtgttcctcgac
aacgacgcaaacgccgccgcatacggcgaagcagtctacggagcgggtcgggcatttcca
gactttctcatggtgacgcttggcaccggagtcggcggcggcatcgttctcaaccataag
ctctaccgcgggccgaatggaacggctggagaggtcgggttcatgattgtcgattacaat
ggctcctcactccatgccggcatccgcggtacgcttgaaggactcatcggcaaggaccgt
ctggtggagatggcgcggcggatgatcgccgagcacccctctccgtcttcagtcggagct
ctctgcggcaatgactgggcttcgctttcgccgcgtcatctcgaaactgcagcgcttgaa
ggggaccttgcggcgaaggacgtatggacccgggtcggttccatactcggcacagggctt
gcaagcgtcactgcgcttatggatatcaggaagtttgtcgtcggaggcgggatttcggcg
gccggagatctcctcctgaaaccagccctcgcggcactgcagcgatctaccctgccttcc
atgcacgatggactttcagtcgtcagggccgagctcggcaaccgggccggcatgcatgga
gcggctgctctctgcttcagcggtgaatga

DBGET integrated database retrieval system