KEGG   Pelodictyon luteolum: Plut_0255Help
Entry
Plut_0255         CDS       T00291                                 

Definition
(RefSeq) magnesium-chelatase subunit H (EC:6.6.1.2)
  KO
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
plt  Pelodictyon luteolum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Plut_0255
Enzymes [BR:plt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Plut_0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(254036..257839)
Genome map
AA seq 1267 aa AA seqDB search
MHDKIRIAAVVGMEQCNQRVWREVSDMISAHAELTQWTDQDLEHQNPEAAEAIRNADCVF
TTLIQFKGQADWLEEQLKASKVKTVFAYESMPEVMQMTKVGTYVVSGDGGGMPDIVKKVA
KMLVKGRDEDALYGYMKLLKIMRTMLPLIPKKAKDFKNWMQVYTYWMHPTAENLAGMFNY
IMAEYFEVGVKAEKVQEVPTMGFYHPDAPEYMKDLHHYEKWLHKHDKASAKRRNIAMLFF
RKHLLQEKEYIDNTIRAIESRGLNPLPVFVMGVEGHVAAREWFTHGNVDMLVNMMGFGFV
GGPAGATTPGASAAARDEILQKIDAPYVVAQPLFIQDVNSWKKEGVVPLQSAMTYSLPEM
DGAVCPVVLGAIKDGRLHTVQDRLDRLSLIAKKFSDLRHMPNSEKKVAFVVYDYPPGMGK
KASAALLDVPKSVYAMLLKLKDEGYNVGELPESPEAMLAMLDRATDYEIQAHEQDCFSID
REIFNRITTDRERERIEGRWNGFPGDIVPVGPDRLFIGGIQFGNVFIGVQPRLGIQGDPM
RLLFDKENTPHHQYIAFYRWISREFGANAMIHVGMHGTVEWMPGLQLGVTGDCWPDALLG
EVPHFYIYPINNPSEANIAKRRGYATMISHNIPPLARAGLYKELPAFKEMLNDYRERGLE
KIVDVETEEAIIDKARQLNLTDDCPRVEGEAFQEYISRLYTYMMELEGRLISNSLHVFGA
TPQLETQVTTITEYLKVRGNEKSLPSIILQAIGENGTYGDYATLATRARKGESAAMQVRE
RVDGHTRDFISGTIFERGNPASVFSTLTGGAQVSKEMAEAINESLKEGLAMKTALEDNSG
EMRSFVHALSGGYLPSGPGGDLVRDGAGILPTGRNIHAIDPWRIPSELAFKRGKQIADSI
LQRHVEENNGEYPESIAQVLWGLDTIKSKGEAVAVIIHLMGAEPAYDAQGKISHYALIPL
EKLKRPRIDVLIQISSIFRDTFGVLVDHLDKLVKDAAKADETHEMNHIKKHVDIAMQNGA
DFEAATSRLFTQAPGSYGSQVEELVEDSAWETEQDLDDMFVKRTGFAYGGNRYGDQQTDI
LKGLLGTVDRVVQQVDSAEFGISDIDRYFSSSGALQLSARRRNPKGDNVKLNYVETFTAD
VKIDDADKALKVEFRTKLLNPKWFETMLEQGHSGAAEISNRFTYMLGWDAVTKGVDDWVY
KEAAETYAFDPNMRDRLMKANPKAFKNIVGRMLEASGRGMWNADPDMIDKLQEIYSDLED
RLEGIEV
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atgcacgataaaatcagaatcgcagcagtcgtcgggatggagcaatgcaaccagagggtc
tggcgcgaggtcagtgatatgatttccgcccatgctgaactgacccaatggaccgatcag
gatctcgaacaccagaaccccgaagccgccgaagcaatccgcaatgcggactgcgttttc
accaccctcatccagttcaagggacaggccgactggctcgaagagcagctgaaagcctcg
aaggtcaagaccgtgtttgcctatgagtcgatgcctgaagtgatgcagatgacgaaggtg
ggtacgtacgtggtatcaggagacggcggaggcatgccggacatcgtgaagaaggttgcc
aagatgctggttaagggccgcgacgaagacgcgctctatggctacatgaagctgctgaag
atcatgcggaccatgctgcccttgattccgaagaaagcaaaggatttcaagaactggatg
caggtctatacctactggatgcatccgactgcggagaacctcgccgggatgttcaactac
atcatggcagaatacttcgaagtgggcgtgaaggccgagaaggtgcaggaggtccccacc
atgggcttctaccatcccgacgccccggaatacatgaaagatctgcaccactatgagaag
tggctgcacaaacacgacaaggcatcagccaaaaggcgcaacatcgccatgctcttcttc
cgcaagcacctgttgcaggagaaggaatatatcgacaacaccatccgcgccatcgagtca
cggggcctcaatcccctgccggtgttcgtgatgggtgtggaaggacatgtggctgcaaga
gagtggtttacgcatggcaatgtcgacatgctcgtcaatatgatgggattcgggttcgtc
ggcggccctgccggtgcgaccaccccgggagcctcagccgctgcgcgtgacgagatcctc
cagaaaatcgacgcaccctacgttgtggcccagccgctcttcatccaggatgtgaattca
tggaagaaagagggcgtggtaccgctgcagtcggccatgacctactcgcttcccgaaatg
gacggcgcggtctgtcccgtcgtgctcggcgccatcaaggacggccgcctgcacacggtg
caggaccgcctcgaccgcctctccctcattgcaaagaagttctctgacctccgtcacatg
ccgaacagcgagaagaaagtcgcgttcgtggtctacgactacccgcccggcatgggcaag
aaagcaagcgcggcactgctcgacgtaccgaagagcgtctacgccatgctcctgaaactg
aaagacgagggatacaatgtcggcgaactcccggaatcaccggaagccatgctcgccatg
cttgatcgcgccaccgactacgaaatccaggcccacgagcaggactgcttctcgatcgac
cgcgaaatcttcaaccgcatcaccaccgaccgcgagcgcgagcgtatcgaaggccgctgg
aacgggttcccgggtgacatcgtccccgtcggaccggaccggctgttcatcggcggcatc
cagttcggcaacgtgttcatcggtgtgcagccgcgcctcggcatacagggcgacccgatg
cgcctgctcttcgacaaggagaacaccccgcaccaccagtacatcgcattctaccgctgg
atcagccgtgagttcggggccaacgcaatgattcatgtcggcatgcacggcaccgttgaa
tggatgcccggcctgcagctcggcgtcaccggtgactgctggcccgatgcgctgctcggc
gaggttccgcatttctacatctacccgataaacaaccccagcgaagccaacatcgccaag
cgccgcgggtatgcgaccatgatttcgcacaacatccccccgcttgcccgcgccggcctc
tacaaggagctgcccgcgttcaaggagatgctgaacgactacagggagcgcggcctcgag
aaaatcgtcgacgtggagaccgaagaggccatcatcgacaaggcccgccagctcaacctg
accgacgactgcccgagggttgagggggaagcgttccaggagtacatcagccgcctctac
acctacatgatggagcttgagggtcgactgatctccaattcgctgcacgtgttcggcgca
accccccagcttgagacccaggtgaccaccatcaccgagtacctgaaggtgcgcggcaac
gagaagtcactgccctccatcatcctgcaggccatcggcgaaaacggaacctacggcgac
tacgcaaccctcgccacccgggcaaggaaaggcgagtcagccgccatgcaggtacgcgaa
cgggtggacggacatacccgcgacttcatttccggaaccattttcgaacgcggcaatccg
gcatcggtgttcagcaccctgaccggaggagcgcaggtttcaaaagagatggctgaagcc
atcaacgaatcgctgaaagagggtcttgcgatgaaaaccgcccttgaggacaacagcgga
gagatgcgtagcttcgtgcatgcgctctccggcgggtacctcccctcgggccccggcggc
gaccttgtacgcgacggcgcaggcattctgcctaccggacgcaacatccacgccatcgac
ccgtggcgcattccttccgaactggctttcaaacgtggcaagcagattgccgacagcatc
ctgcagcgccatgtggaagagaacaacggcgagtaccccgaaagcatcgcccaggttctc
tggggcctcgacaccatcaagagcaagggtgaagccgtcgcggtgatcatccacctgatg
ggagccgaaccggcatacgatgcacagggcaagatcagccactacgcgctcattccgctc
gaaaagctcaagaggccgcgcatcgacgtgctcatccagatcagctccatcttccgcgac
accttcggcgtgctcgtcgaccatctcgacaagctggtgaaggatgccgccaaggctgat
gagacccatgagatgaaccacatcaagaaacatgtcgacatcgccatgcagaacggcgcc
gacttcgaagccgcaacttcacgcctcttcacccaggctcccggctcatatggttcacag
gtcgaagagctggtggaagactcggcatgggaaacggagcaggacctcgacgacatgttc
gtcaaacgcaccggattcgcatacggcggaaaccgctatggcgaccagcagaccgacatc
ctgaaaggactgctcggcaccgtcgaccgggtggtgcagcaggtcgactccgcggagttc
ggcatttccgacatagaccgctacttctcctcctccggagcgctgcagctctccgcacgc
cgccgcaacccgaagggcgacaacgtgaagctcaactatgtggagacctttacggcggac
gttaagatcgacgacgcagacaaggcgctgaaggtggagttccgcacgaagctcctcaac
ccgaaatggttcgagacgatgctcgagcagggccacagcggagccgccgaaatcagcaac
cgcttcacctacatgctcggctgggacgccgtcaccaagggtgtcgacgactgggtctac
aaagaagccgcagagacctacgccttcgacccgaacatgcgcgaccggctcatgaaggcg
aaccccaaggccttcaagaacatcgtcggccgcatgctcgaagcaagcggacgcggcatg
tggaacgctgatccggacatgatcgacaagctccaggagatatactccgaccttgaagac
cgcctggaaggcatcgaggtataa

DBGET integrated database retrieval system