KEGG   Pelodictyon luteolum: Plut_0268Help
Entry
Plut_0268         CDS       T00291                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
plt  Pelodictyon luteolum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:plt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(274477..274986)
Genome map
AA seq 169 aa AA seqDB search
MKLHTAYIGTGSNIGDRLSHLQEAVCRLGALPETKVLRASPVYMTEPVGEEEQERFYNGV
VQIETGLTPENLRSATKAIEQELGRPERYRRWSPRVIDLDILLYADCIIETDTLRIPHPE
LHRRKFVLIPLLDIANPLHPVLRKTILQMLRTCGDRSVPVRLRERLRLH
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccacacagcatacatcggaacgggatcgaacatcggggaccgcctcagtcac
ctgcaggaagccgtatgtcggctcggcgcgctcccggaaacgaaggtgctccgagcctcg
cccgtctacatgacagagccggtcggggaagaggaacaggaacgattctacaacggcgtg
gtacagatagaaaccggcctcacgcctgaaaaccttcggagcgcaacaaaggctatagag
caggaactcggccggcccgaacgataccggagatggagcccgagggtcatagacctcgat
atcctcctctatgcagactgcataatcgagactgatacgctccggattccccacccggaa
ctgcaccgcagaaaattcgtgctcatcccgctgctcgacatcgcaaaccctctgcacccc
gtcctcagaaaaaccatccttcagatgctccggacgtgcggcgaccggtcggtacccgtg
cgccttagggaacgactccgtctgcactga

DBGET integrated database retrieval system