KEGG   Pelodictyon luteolum: Plut_0274Help
Entry
Plut_0274         CDS       T00291                                 

Definition
dihydroflavonol 4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
plt  Pelodictyon luteolum
Brite
Enzymes [BR:plt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Plut_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
279633..280697
Genome map
AA seq 354 aa AA seqDB search
MFKNRGAHWRSVRPSGGAELPYSRFMSTASIAITGATGYIGSQLLLSLMRGAGGGEGVRI
VAREGSDCSFSGTLPVEVVRADILNQPALDLAFRGIDTVFHSAGLISYTKRHTGELYDVN
VLGTRNVVNACLNAGVRRLVVTSSMAAAGATEDGSPVGESASFQDWQRRNGYMESKHLAE
LEVLRGAAEGLEAVMVSPGVVIGRDPSNPASKSSSNDVLRLIYQGRIPVHPTGGTGFVDV
SDVVDALIAGWRLGRSGERYLVVGHNMTFKELYLRIAELPGSRTRPTIALPGPIGSLAGI
GGELYSWISGRPSFISIESIRLAGRRASYSNMKSTEELQVSYRPLEETLLSAVT
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaacagaggcgctcactggcggagcgtgcgcccttccggaggggccgaacta
ccttatagccgattcatgtccactgcatccattgccattaccggcgcgaccggttacata
ggttcgcagctgctgctttcgctcatgaggggtgccggcggcggtgagggggtgcggatc
gttgcccgtgagggctcggactgctccttttcgggcacccttcccgtggaggtcgtgcgg
gcggacatcctgaaccagcctgcgcttgatctggcattccggggcatcgacaccgtgttc
cactctgcggggctgatttcctatacgaagcgccacactggcgagctctacgacgtcaat
gtcctcggcacccgaaacgtggtgaacgcatgcctcaacgccggggtccggcgtctggtc
gtcaccagctcgatggccgcggccggcgccaccgaggatggttcgccggtcggtgaatcg
gcttctttccaggactggcagcgccggaacgggtacatggagtcgaagcatcttgccgaa
ctcgaggtcttgcgcggagccgccgaggggcttgaggccgtcatggtgagcccgggggtt
gtcatcggccgggacccctcgaatcctgcgtcgaagagctcatcgaacgatgtcctgcgc
ctcatctatcagggacgcatcccggtgcatccgacgggcggtaccggttttgtcgatgtt
tctgacgtcgtcgacgccctcattgccggatggcgcctcggccgcagcggtgaacgttat
ctggtggtgggccacaatatgactttcaaggagctttacctgcgcatcgctgagcttccc
ggcagccgcacgcgccccaccatcgccctaccgggtcccatcggctccttggcaggcatc
ggcggcgaactctattcctggatctcaggccgcccgtcgttcatcagcattgagagcatc
cgccttgccgggcggagggcttcatacagcaacatgaaatcaacggaggaacttcaggtc
agctaccggccgcttgaagagactctcttaagcgcagtaacctga

DBGET integrated database retrieval system