KEGG   Pelodictyon luteolum: Plut_0492Help
Entry
Plut_0492         CDS       T00291                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
plt  Pelodictyon luteolum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Plut_0492 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Plut_0492 (pyrB)
Enzymes [BR:plt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Plut_0492 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(573910..574815)
Genome map
AA seq 301 aa AA seqDB search
MSAGTLSGLLDKTEGFKKELTAPAPSFSPSLQGRRIALVFFENSTRTRFSFELAARNLGA
STLGFSASTSSVTKGETLSDTIKNLEAMQVDAFVLRHPSSGSAEFISGITKKPVVNAGDG
ANEHPTQALLDMFTLREHFGTLKAIKVAIIGDVLHSRVARSNIHGLLTMGAEVGLCSPVT
LLPPDSEKLGVSLFTDLDQALGWADAALVLRLQLERATGGYLPSLQEYSVHYGLTDERLE
RTARHLLVLHPGPINREIEISNRVADRIQPPGYSKSMLLEQVTNGVAVRMAVLQTLLADT
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccggcaccctcagcggactgctcgacaaaactgaaggcttcaagaaagagctc
accgcacccgccccgtctttcagcccctctcttcagggcagacggatcgcgctggtgttt
tttgaaaactccaccagaacccgcttctcgttcgaacttgcggcaaggaacctcggagcc
tccacgctcggcttcagcgcctcaacgagcagcgtcaccaagggtgagacactcagcgat
accatcaagaacctggaagccatgcaggtcgatgccttcgtcctgcgccacccatcctca
gggagtgcggagttcatcagcggcatcacaaaaaaacctgtcgtaaacgccggtgacggc
gcaaacgaacacccgacccaggccctgctcgacatgttcaccctgcgtgaacacttcgga
acgctcaaggccataaaggtggccatcatcggcgacgtgctccacagccgggtggcccgt
tcaaacattcacggactgctcacgatgggtgccgaagtcggcctctgcagcccggtgacc
cttcttccgccagactcggaaaaactcggcgtcagccttttcaccgaccttgaccaggcc
cttggctgggccgatgccgccctggtgctccggctgcagcttgaacgcgcgaccggcggc
tacctcccctctctgcaggagtactccgtccattacgggcttaccgatgaacggcttgag
cggactgcccggcacctgctggtgctgcatccaggaccgataaaccgtgaaatcgaaatc
tctaaccgcgtggcagaccgcatccagccacccggatactcgaaaagcatgttgctcgaa
caggtcaccaacggcgttgccgtccgtatggcggtgctccagaccctgcttgccgataca
ccttag

DBGET integrated database retrieval system