KEGG   Chlorobium luteolum: Plut_0497Help
Entry
Plut_0497         CDS       T00291                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
plt  Chlorobium luteolum
Pathway
plt00020  Citrate cycle (TCA cycle)
plt00640  Propanoate metabolism
plt00660  C5-Branched dibasic acid metabolism
plt00720  Carbon fixation pathways in prokaryotes
plt01100  Metabolic pathways
plt01110  Biosynthesis of secondary metabolites
plt01120  Microbial metabolism in diverse environments
plt01130  Biosynthesis of antibiotics
plt01200  Carbon metabolism
Module
plt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
plt_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
plt_M00614  Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plut_0497
   00640 Propanoate metabolism
    Plut_0497
   00660 C5-Branched dibasic acid metabolism
    Plut_0497
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Plut_0497
Enzymes [BR:plt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Plut_0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A OKR_DC_1_N ATP-synt_DE ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABB23385
JGI: Plut_0497
UniProt: Q3B5J6
Position
complement(581886..583061)
Genome map
AA seq 391 aa AA seqDB search
MNIHEYQGKDILRKFGVAVPKGIVAYSAEEAKQAAEQLFAEQDSPVVVIKAQIHAGGRGK
AGGVKLAKSPEEAHEIASQMLGTTLVTHQTGPEGKEVRRLLVEEGMNIDREFYVGITLDR
ATSNNVLMISTEGGMEIEKVAEETPELLLKIQVDARFGLQGFQAREAAFFLGLEGEQFRN
AVSFITALYNAYTSIDAALAEINPLVVTKEGRVLALDAKINFDSNALYRHKDFIELRDIS
EEDPFEVEASKSNLNYVRLDGNVGCMVNGAGLAMATMDMIQLAGGRPANFLDVGGGASPQ
TVEEGFKIILSDKNVKAILVNIFGGIVRCDRVAGGIIEAARKIGLNLPVIVRLEGTNADI
AQKMLDESGLNLIAADGLKDAAQKVNQALSA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaatatcagggcaaggatatcctgaggaaattcggggtggccgtgccg
aaaggaatcgtcgcctattcggctgaggaggccaagcaggcagctgagcagctgttcgcc
gagcaggacagccctgtggtggtcatcaaggcccagatccatgcgggcggccgcggcaag
gccggcggggtgaagctcgccaagtctcccgaagaggcgcatgagatcgcatcgcagatg
ctcggcaccaccctcgtcacgcaccagaccggccccgagggcaaagaggtacgcaggctt
cttgtcgaagagggcatgaacatcgaccgcgagttctacgtcggcatcaccctcgaccgc
gcaacttcgaacaacgtcctcatgatctccactgagggcggaatggaaatcgagaaggtt
gccgaagagaccccggagctgcttctgaagatccaggttgacgcacgtttcggcctccag
ggcttccaggcccgcgaggcggcattcttcctcggcctcgagggcgaacagttccgcaac
gcagtcagcttcatcaccgcgctctacaacgcatacacttcgattgatgcggcgctagcc
gaaatcaacccgcttgtcgtcaccaaagagggacgcgtgctcgccctcgacgccaagatc
aacttcgactcaaacgccctgtaccgccacaaggacttcatcgagctccgcgacatctcc
gaagaggaccccttcgaagtcgaggcctcgaaatcgaacctcaactatgtccgcctcgac
ggcaacgtcggctgcatggtcaacggcgcaggccttgccatggcgacaatggacatgatc
cagcttgccggtggacgccccgccaactttctggacgtcggcggtggagcgagcccccag
acggtcgaggaaggcttcaagatcatcctcagcgacaagaacgtcaaggcgatcctcgtc
aacatctttggcggcattgtccgctgcgaccgtgttgccggcggcatcatcgaggctgcc
aggaaaatcggactgaatctgccggtcatcgtgcgccttgagggtacgaacgccgacatt
gcgcagaagatgctcgatgaatcaggcctgaacctcatcgcagccgacggcctgaaggac
gccgcccagaaagtgaaccaggcgctctcggcctga

DBGET integrated database retrieval system