KEGG   Chlorobium luteolum: Plut_0535Help
Entry
Plut_0535         CDS       T00291                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
plt  Chlorobium luteolum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Plut_0535
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plut_0535
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Plut_0535
Enzymes [BR:plt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Plut_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(625335..626534)
Genome map
AA seq 399 aa AA seqDB search
MSTTAYSAPDSAGKFGAFGGRFTPETLMQNAAGLEAEYLKAKSDPEFQRTLEGLLGDYVG
RPTPLYHAEGLSGMLGGAEVWLKREDLCHTGAHKINNALGQVLLARRMGKRRVIAETGAG
QHGVATATVCALFNLQCVVYMGEEDIRRQAPNVARMKLLGAEVRPVSSGSRTLKDATSEA
IRDWMNNPEETFYIIGSVVGMHPYPMIVRDFQAVIGRETRRQILDKAGRLPDVITACIGG
GSNAVGMFYDFLPDAGSIELIGVEAAGEGLDRRHAASLTMGSPGVLHGAMTMLLQNEDGQ
IQEAHSISAGLDYPGVGPEHCHLQELGLVKYTSVTDADALSALRTLAETEGIICALESAH
AVRYAITRAPEMAKDKIIIVNLSGRGDKDMGTIMEELNL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaacagcatactcagcccctgactccgcaggcaaattcggtgcattcggcggc
cggttcacccccgaaaccctcatgcagaacgcggccggtctggaggccgaatacctgaag
gcaaaatcggatcctgaattccagcgcacactcgagggactgctcggcgactatgtggga
cgtccgaccccgctctaccatgccgaagggctcagcggcatgctcggcggtgcagaagtc
tggctgaaacgcgaagacctctgccataccggagcacataaaatcaacaatgccctcggt
caggtgctgcttgcccggaggatgggaaagcggcgcgtcatcgccgaaaccggcgccggc
cagcacggggtggccacagccaccgtctgcgccctgttcaacctccagtgcgtggtctac
atgggtgaggaagacatccgccgccaggcacccaacgtcgcccgcatgaagctgctcggc
gccgaggtccgccctgtctcaagcggatcacgaaccctaaaggatgctacgagcgaagcc
atccgggactggatgaacaatccggaagaaacgttctacatcatcggttccgtcgtcggc
atgcacccctaccccatgatcgtgcgcgacttccaggctgtcatcggccgtgaaacccgc
cgccagatactggataaggcaggccgcctgccggacgtcatcaccgcctgtatcggaggt
ggcagcaacgccgtcggtatgttctacgacttcctgccggacgccggcagcatcgaactc
atcggcgtcgaagccgccggcgaaggtcttgaccggcgccacgccgcctccctcaccatg
ggcagccccggcgtgcttcacggcgccatgaccatgcttctccagaacgaggacggccag
atacaggaagcgcactcaatatcagcaggacttgactaccccggtgtcggccccgagcac
tgccacctgcaggaactcggcctcgtcaagtacacctccgtcaccgatgccgatgccctt
tcggcgctgcgtacgctggccgaaaccgaaggcatcatctgcgccctcgaatcggcccat
gccgtccgctacgccatcacccgggcccctgaaatggctaaggacaagatcatcatcgtc
aacctctccggacgcggcgacaaggatatggggaccatcatggaggaactgaatctctga

DBGET integrated database retrieval system