KEGG   Chlorobium luteolum: Plut_0545Help
Entry
Plut_0545         CDS       T00291                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
plt  Chlorobium luteolum
Pathway
plt00260  Glycine, serine and threonine metabolism
plt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plt01100  Metabolic pathways
plt01110  Biosynthesis of secondary metabolites
plt01130  Biosynthesis of antibiotics
plt01230  Biosynthesis of amino acids
Module
plt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plut_0545
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Plut_0545
Enzymes [BR:plt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Plut_0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ABB23429
JGI: Plut_0545
UniProt: Q3B5F2
Position
637627..638439
Genome map
AA seq 270 aa AA seqDB search
MTQKKENRITARLREDRKLLLAYYMPEFPVAGSTLPVLEALQDGGADIIELGIPFSDPVG
DGPVIQNAAHIAIRNGVSVRSLLELVRKARAGEGCRKITVPILLMGYSNPLIAYGGDCFL
HDAVKAGVDGLLIPDLPPEESADFLQRAKSLGLTVVYLISPVTPPERIEWIDSLSTDFSY
CLAVNATTGTAKLADASTEASVDRYLERVRLHARKKFVVGFGIRDRARVEHMWRLADGAV
VGTALLEHIAGAPNPGEAARRAGEFWRGLR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttgacacagaagaaagagaacaggataacggcacggctccgtgaggaccgcaagctcctg
cttgcctactacatgcccgagtttcccgtagcgggctccacgctgccggtgcttgaggca
ctccaggatggtggcgccgacatcatcgagctcggcatacccttttccgatccggtcggc
gatggtccggtgatccagaatgcggcgcacatcgcaatccggaacggcgtgagtgtccgc
agcctgcttgagctggtccgcaaagccagggcgggggaaggatgcaggaaaatcacagtt
ccgattctcctcatgggctacagcaatccgcttatcgcatacggaggagactgtttcctc
cacgatgctgtcaaagcaggggtggacgggctgctcattccggaccttcctcccgaggag
tcggctgacttccttcagagggccaaatctctcggccttacggtggtttacctgatctcc
cctgtgactcctccggaacggatcgaatggatcgacagcctctcgacagacttttcctac
tgcctggccgtcaacgccacgaccgggaccgcaaagcttgccgacgcatcaaccgaagct
tcggttgaccggtaccttgagcgggtccgcctgcatgcccggaagaagttcgtggtcggg
ttcggcatcagggaccgggcgagggttgagcatatgtggcgcctggccgacggggcggtg
gtcggcaccgccctcctcgagcatatcgccggagccccgaaccccggggaggcggcccgt
agggctggagaattctggcgggggctgcggtga

DBGET integrated database retrieval system