KEGG   Pelodictyon luteolum: Plut_0554Help
Entry
Plut_0554         CDS       T00291                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
plt  Pelodictyon luteolum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:plt01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:plt00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
647524..648855
Genome map
AA seq 443 aa AA seqDB search
MSPVHYRTSTSTIVAVLKLYRFLDDRDALFRQIGRSVDFDPEVQRAVTDILEAVRLRGDM
AVLEYTERFQGAVLTSMQVPEEDILRAREEADPAFIRVLEEAWENILRFHRHEVENSFFY
EGEGGVVLGQRVTPMDRAMLYVPGGKASYPSSVLMNAAPARVAGVGEIFMTTPCDASGAV
SPHILAAASVAGVTSVYRLGGAQAVAAFAYGTQTIPKVDIITGPGNKYVALAKKQVFGHV
AIDSIAGPSEVVVVADDDADAEFITMDLFAQAEHDPDASSVLITPSMRLAEEVRDLAAAR
VGSMLRGEVIAEALSNNGAIVVVADIEEACRVSDMIAPEHLELHVLHPWELLASIRHAGA
VFMGGYSCETVGDYYAGPNHTLPTNGTARFFSPLSVRDFVKHTSIISYTRRQIMACGERI
ASFADHEGLEAHAEAVRARLKKG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaccagtgcattacaggacttcaacctcaacgattgtggcagtgctcaagctttac
cgatttctcgatgaccgcgatgccctcttccgccagatagggcgcagtgttgacttcgat
cccgaggtccagcgggccgttaccgacatactcgaggccgtccgcctccgcggcgacatg
gccgtgctggaatacaccgagcgcttccagggcgcagtcctcacctccatgcaggtgccg
gaagaggatatccttcgcgcaagagaggaggccgatcccgcattcatcagggtgcttgag
gaggcatgggagaatatcctccgtttccaccgccatgaggtggaaaacagctttttctat
gagggtgaaggcggtgtcgtgctcggccagcgtgttacccccatggacagggctatgctt
tacgtgcccggcggcaaggcatcctatccctcttccgtcctgatgaatgcggcccccgcg
cgcgtcgccggagttggcgagatcttcatgaccacgccctgcgatgcttcgggggcggtc
agtccgcacattctcgccgcggcttctgtcgccggcgtgacctccgtataccgtcttggc
ggcgcacaggccgttgccgccttcgcttatggcacccagaccatccccaaagtcgacatc
atcaccggtcccggcaacaagtatgtggcccttgccaagaagcaggtattcggtcatgtc
gccatcgacagcattgcaggcccctcggaagtggttgtcgtggcggacgatgatgccgat
gcggagttcatcacgatggacctcttcgcccaggccgagcacgatcccgatgcatcgtcc
gtcctcatcaccccttccatgcggcttgccgaggaggtccgtgaccttgcggccgcccgt
gtcggctccatgctccgcggggaggtgatcgcagaggcgctcagcaacaacggcgccatc
gtcgtggtggcggacattgaggaggcctgccgggtctccgacatgatcgctcccgagcat
ctggagctgcacgtgctgcacccgtgggagcttttagcctcgatccgccacgccggtgcc
gtcttcatgggcgggtactcctgcgagacggtcggtgactattacgccggcccgaaccat
accctgccgaccaacggcacggcgcgcttcttctcgccgctttccgtgcgcgatttcgtg
aagcacacctccatcatctcctacacccgcaggcagatcatggcgtgcggggagaggatc
gcctcctttgccgaccatgaggggctagaggcccatgctgaagccgtccgggcaaggttg
aagaaaggatga

DBGET integrated database retrieval system