KEGG   Pelodictyon luteolum: Plut_0554Help
Entry
Plut_0554         CDS       T00291                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
plt  Pelodictyon luteolum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Plut_0554 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    Plut_0554 (hisD)
Enzymes [BR:plt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Plut_0554 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
647524..648855
Genome map
AA seq 443 aa AA seqDB search
MSPVHYRTSTSTIVAVLKLYRFLDDRDALFRQIGRSVDFDPEVQRAVTDILEAVRLRGDM
AVLEYTERFQGAVLTSMQVPEEDILRAREEADPAFIRVLEEAWENILRFHRHEVENSFFY
EGEGGVVLGQRVTPMDRAMLYVPGGKASYPSSVLMNAAPARVAGVGEIFMTTPCDASGAV
SPHILAAASVAGVTSVYRLGGAQAVAAFAYGTQTIPKVDIITGPGNKYVALAKKQVFGHV
AIDSIAGPSEVVVVADDDADAEFITMDLFAQAEHDPDASSVLITPSMRLAEEVRDLAAAR
VGSMLRGEVIAEALSNNGAIVVVADIEEACRVSDMIAPEHLELHVLHPWELLASIRHAGA
VFMGGYSCETVGDYYAGPNHTLPTNGTARFFSPLSVRDFVKHTSIISYTRRQIMACGERI
ASFADHEGLEAHAEAVRARLKKG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaccagtgcattacaggacttcaacctcaacgattgtggcagtgctcaagctttac
cgatttctcgatgaccgcgatgccctcttccgccagatagggcgcagtgttgacttcgat
cccgaggtccagcgggccgttaccgacatactcgaggccgtccgcctccgcggcgacatg
gccgtgctggaatacaccgagcgcttccagggcgcagtcctcacctccatgcaggtgccg
gaagaggatatccttcgcgcaagagaggaggccgatcccgcattcatcagggtgcttgag
gaggcatgggagaatatcctccgtttccaccgccatgaggtggaaaacagctttttctat
gagggtgaaggcggtgtcgtgctcggccagcgtgttacccccatggacagggctatgctt
tacgtgcccggcggcaaggcatcctatccctcttccgtcctgatgaatgcggcccccgcg
cgcgtcgccggagttggcgagatcttcatgaccacgccctgcgatgcttcgggggcggtc
agtccgcacattctcgccgcggcttctgtcgccggcgtgacctccgtataccgtcttggc
ggcgcacaggccgttgccgccttcgcttatggcacccagaccatccccaaagtcgacatc
atcaccggtcccggcaacaagtatgtggcccttgccaagaagcaggtattcggtcatgtc
gccatcgacagcattgcaggcccctcggaagtggttgtcgtggcggacgatgatgccgat
gcggagttcatcacgatggacctcttcgcccaggccgagcacgatcccgatgcatcgtcc
gtcctcatcaccccttccatgcggcttgccgaggaggtccgtgaccttgcggccgcccgt
gtcggctccatgctccgcggggaggtgatcgcagaggcgctcagcaacaacggcgccatc
gtcgtggtggcggacattgaggaggcctgccgggtctccgacatgatcgctcccgagcat
ctggagctgcacgtgctgcacccgtgggagcttttagcctcgatccgccacgccggtgcc
gtcttcatgggcgggtactcctgcgagacggtcggtgactattacgccggcccgaaccat
accctgccgaccaacggcacggcgcgcttcttctcgccgctttccgtgcgcgatttcgtg
aagcacacctccatcatctcctacacccgcaggcagatcatggcgtgcggggagaggatc
gcctcctttgccgaccatgaggggctagaggcccatgctgaagccgtccgggcaaggttg
aagaaaggatga

DBGET integrated database retrieval system