KEGG   Pelodictyon luteolum: Plut_0785Help
Entry
Plut_0785         CDS       T00291                                 

Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
plt  Pelodictyon luteolum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Plut_0785
Enzymes [BR:plt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Plut_0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
900176..901330
Genome map
AA seq 384 aa AA seqDB search
MTQTETAAKKTAARKTVAKKAAAAPAPKKAAAPAKKKSGLAFPFTAIVGQEEMKLSLILN
IIDPRIGGVLVMGHRGTGKSTTVRALAEVLPFIERVQDDIYNRTPSQFVEGEDARKGAKA
IDPATLKTEKIPVPVVDLPLGATEDRVCGTIDIEQALTSGVKAFEPGLLAQANRGFLYID
EVNLLDDHLVDVLLDVAASGKNVVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGL
HARIITILDVAKRVDIVKRRRDFDEDPDAFMKKYNREQVKLQKKIQTAKDLLPEVTMSDE
VLTDIARLCMNLGIDGHRGELTITRTAHAHAAFMGQKVVTMKHVREIAGLCLRHRLRKDP
LETLDAGEKIERELAKVLGEAEAV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgactcagactgaaacagctgccaagaaaactgctgccaggaaaacagttgccaagaag
gccgcagcggctcctgcacccaaaaaggctgcagctcctgccaagaagaagtccggcctt
gcgtttcctttcaccgccatcgtcggccaggaggaaatgaagctcagtctgatcctcaac
atcatcgatccgaggatcggcggcgtgctcgtcatgggccacaggggtaccggcaagagc
accacggtccgtgcgcttgcagaggtgcttcccttcatcgaacgcgtacaggacgacatc
tacaaccgcaccccttcgcagtttgtcgagggtgaggatgcaaggaaaggcgcaaaagcg
atcgaccccgcaaccctgaagaccgagaagatccccgttcccgtcgtcgaccttccgctc
ggtgcgactgaagaccgcgtctgcggtaccatcgacatcgaacaggcgctcaccagcggc
gtcaaggccttcgagccgggtctgctcgcccaggccaaccgcggcttcctttacatcgac
gaggtcaacctcctcgacgaccaccttgtcgacgtgctgcttgatgtggccgccagcggc
aagaacgtggtcgagcgcgagggcatcagcatccgccacccggcccgcttcgtgctcgtc
ggttccggcaaccccgaggaaggcgagctccgcccgcagctcctcgaccgtttcggcctc
catgcccgcatcatcaccatcctcgacgtcgccaagcgtgtcgacatcgtcaagcgccgc
cgtgacttcgatgaggacccggatgccttcatgaagaagtacaaccgcgagcaggtcaag
ctgcagaagaagatccagaccgccaaggacctgcttccggaagtgacgatgagcgacgag
gtactgaccgacatcgcccgcctctgcatgaacctcggcatcgacggccaccgcggtgaa
cttaccatcacccgtaccgcccacgcccacgccgccttcatgggccagaaggtggtcacc
atgaagcatgtcagggagatcgcaggactctgcctccgccaccgcctccgcaaggatccg
ctggagacgcttgatgctggagagaagatcgaacgtgagctcgcaaaagtccttggagaa
gcagaagcagtataa

DBGET integrated database retrieval system