KEGG   Chlorobium luteolum: Plut_0787Help
Entry
Plut_0787         CDS       T00291                                 

Definition
(GenBank) cobaltochelatase CobN subunit
  KO
K03403  magnesium chelatase subunit H [EC:6.6.1.1]
Organism
plt  Chlorobium luteolum
Pathway
plt00860  Porphyrin and chlorophyll metabolism
plt01100  Metabolic pathways
plt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Plut_0787
Enzymes [BR:plt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Plut_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobN-Mg_chel DUF3479 PSD2
Motif
Other DBs
NCBI-ProteinID: ABB23660
JGI: Plut_0787
UniProt: Q3B4S1
Position
903323..907150
Genome map
AA seq 1275 aa AA seqDB search
MSQLRKIVAVVGLEQYNAGLWRKIKGLLSGEAELTQLSDVDLEKQHPEAATALREADCVF
MSMIQFKEQVDWFKEQVEAGTPGKTIFVFESMPEAMSLTKVGSYGTGDGKAGMPDMVKKV
AKMLVKGRDEDALYGYMKLMKIMRTILPLVPAKAKDFKNWLLVYSYWMQPTAENIANMFR
LILKEYFNEPVTVGAIVDVPNMGLYHPDAPEYFKDVKSYKSWMKKRGVNMDKGRRIALLF
FRKHLIQEKTYIDNTIRVLEKHGIQLYPAFVTGVEGHVLVRDWLLKEKLDMLVNMMGFGL
VGGPAGSTKPGIAADARHEILSKLDAPYMVAQPLLTQEYESWHELGVSPMQVTFTYSIPE
MDGAVCPVILGALRDGKVETVPERLERLAILVKQWLRLRETANREKKLALIVYDYPPGLG
KKASAALLDVPKTLFAVLQRLKKEGYEVGKLPESSDELFRLLDRATDYQALQNRREALTV
SHERFKELTTAGERERIEERWQSFPGEIVPMGTEELFIGGIRFGNIFIGVQPRIGVQGDP
MRLLFDKSNTPHHQYIAFYRWISREFQAHAMVHVGMHGSAEWMPGLQTGLTGECWPDALC
GEVPHVYIYPINNPSESTIAKRRGLATMVSHVVPPLSRAGLYKELPALKDLLADYRERNP
RGAGDGSDAAGIEEAIMQKAELLNLTDDCPKREGEPFADFVSRLYIYMSELENRLISNSL
HVFGEASPLESQVTTITETLKNRGENGRTLPTILLASSGKNGHFTGYEELAARSRQGDEE
AIRLREWVEQACRQFVEEVLFQHKSASGVFTAITGGSRPAAEDQPFIEQLMGEGAQLLHA
LRDNTGEMESLMKVLNGRYIASGPGGDLVRDGINVLPSGRNIHAIDPWRIPSELAFKRGT
LIADSIVKKHLEENEGRYPETIAQVLWGLDTIKTKGEAVAVVIRLLGGEPAYDAFGKISH
YGLVPLDRLKRPRIDVLMQLSPIFRDAFGLLMDQLDRLLKEAAKADEPEDMNFVRKHVNE
AIAGGATFEGATSRQFTQSPGAYGTYVDDMIEDSAWESEDDLDDLFIRRNSSAYGGERKG
EKETEILKNLLGSVDRVVHQVDSTEFGISDIDHYFSSSGSLQLAARRRNTRATDVKLNYV
ESFTSDIKVDDAEKSLRVEYRSKLLNPKWFEGMLKHGHSGATEISNRVTYMLGWDAVTKS
VDDWVYKKTAETYALDPEMRERLAKVNPQAIKNIVGRMLEAHGRGMWSADQSTIDELQEI
YADLEDRLEGMTDED
NT seq 3828 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacttcgcaaaatcgttgccgttgtagggctcgagcagtacaacgcaggtctc
tggaggaaaatcaaggggctgctctcgggcgaggccgagctgacccagctgagcgacgtg
gatctggaaaagcagcaccccgaggctgcaacggccctccgggaggccgactgcgtgttc
atgagcatgatccagttcaaggaacaggttgactggttcaaggaacaggtagaggccggt
acccccggcaagaccattttcgtgtttgagtcgatgccggaagccatgtccctgacaaag
gtcggcagctacggcaccggggacggcaaggcgggcatgcccgacatggtgaagaaggtg
gccaagatgcttgtgaaaggccgtgacgaggatgccctctacggctacatgaagctgatg
aagatcatgcgaacgatcctcccgctcgtgccggccaaagcgaaggacttcaagaactgg
ctgctggtatactcctactggatgcagccgacggcggagaacatcgccaacatgttccgt
ctcatcctcaaagagtacttcaacgaaccagtcaccgtcggcgccatcgtcgacgtgccg
aacatgggactctaccatcccgacgccccggagtatttcaaggacgtgaaaagctacaag
tcgtggatgaagaagcgcggagtgaacatggacaaggggcgccgtatcgccctgctcttt
ttccgcaagcacctgatccaggaaaagacctatatcgacaacaccatccgtgtgcttgaa
aagcacggcatccagctctatcccgccttcgtgaccggtgtcgagggccatgtgctcgtg
cgtgactggcttttgaaggaaaaactcgacatgctggtcaacatgatggggttcggcctc
gtcggcggccctgcaggctcgaccaagcccggcatcgcagccgatgcccgccacgagatc
ctctcgaagctcgacgccccctacatggtcgcacagccgctccttacccaggagtatgaa
tcatggcacgagctcggtgtctcgccgatgcaggtgaccttcacctactccatccctgag
atggacggtgccgtctgcccggtcatcctcggtgcgctccgtgacggcaaggtggagacc
gtgcccgagcgtcttgagcgcctcgccatcctcgtcaagcagtggcttcgattgagggaa
acggcgaaccgcgagaagaaactcgccctcatcgtctacgactatccgccgggcctcggc
aaaaaagccagtgcagccctgctcgacgtgcccaaaaccctctttgccgtgctccagcgc
ctgaagaaggaggggtacgaggtcggcaagctgccggaaagttctgatgaactgttccgt
ctgctcgaccgcgcaaccgactaccaggccctgcagaacagacgcgaagcgcttacggta
agccatgagcgattcaaggaactgacgacggcgggcgagcgtgagcgcatcgaagagcgc
tggcagtcgttcccgggcgagatcgttccgatgggcaccgaagagctgtttatcggtggc
atccggttcggcaacatcttcatcggcgtccagccgcgcatcggcgtgcagggggacccg
atgcggcttctgttcgacaagtcgaacaccccgcatcaccagtatatcgcgttctaccgc
tggatcagccgcgagttccaggcccacgccatggtgcatgtcggcatgcacggttcggcc
gagtggatgccgggcctgcagacgggcctgaccggagagtgctggccggacgccctctgc
ggcgaggttccgcatgtctacatctatccgatcaacaacccgagcgagtcgaccatcgcc
aaacggcgcggtcttgccaccatggtctcgcacgtcgtgccgccgctttctcgcgcaggc
ctctacaaggagcttccggccctcaaggacctgcttgccgactaccgcgagcgcaacccg
cggggagcgggtgatgggagcgatgcggcaggcatcgaggaggcaatcatgcagaaggcc
gagctgctcaaccttaccgatgactgcccgaagagggagggagagccgttcgccgacttc
gtcagccgcctctacatctacatgagcgaactcgaaaaccgcctcatatccaactcgctg
catgtgttcggcgaggcaagccctcttgagtcgcaggtcaccaccatcaccgaaaccctt
aaaaaccggggtgagaacggccgtaccctgcccaccatcctgctcgcttcttccggaaag
aacggccacttcaccggctacgaagagctggccgcacgttcccgccagggtgacgaagag
gccatccgtctgcgtgaatgggtcgagcaggcctgccggcagttcgtcgaagaggtcctg
ttccagcacaagtcggcttcgggtgtgtttaccgcaatcaccggcggcagccgccctgcc
gctgaggaccagccgttcatcgagcagctgatgggcgagggagcgcagctcctgcatgcc
cttcgtgacaacacgggcgagatggagtcgctcatgaaggtgctcaacggccgctacatc
gcctctggccccggcggcgacctggtgcgcgacggcatcaacgtcctgccgtccggcagg
aacatccatgccatcgacccctggcggatcccttccgagcttgcattcaagcgcgggacc
ctcatcgccgacagcatcgtcaaaaagcaccttgaggagaatgaaggccgctatcctgaa
accatcgcacaggtgctctggggccttgacaccatcaagaccaagggcgaggccgtggcc
gtcgtcatccgcctgctcggcggtgaacccgcttacgacgccttcggcaagatcagccac
tacggcctcgtgccgcttgatcgcctgaagcgccctcgcatcgatgtgctcatgcagctc
agcccgatattccgtgacgcgttcggcctgctcatggaccagctcgaccgcctgttgaaa
gaggctgccaaagccgatgaacccgaggatatgaactttgtccgcaagcacgtcaacgaa
gccatcgcaggaggagcaacgttcgagggcgcgacgtcgcggcagttcacccagtcgccc
ggcgcctacggcacctacgtcgacgacatgattgaagactccgcctgggagtccgaggac
gacctcgacgatctcttcatccgccgcaacagcagcgcctacggcggtgagcgtaaagga
gagaaggagacggaaatcctcaagaacctgctcggctcggtcgaccgtgtagtccatcag
gtcgattccaccgagttcggcatctccgacatcgaccactacttctcatcgtccggctca
ctgcagcttgccgcacggcggcgcaacaccagggcaacggacgtgaagctcaactatgtc
gagtccttcacctccgacatcaaggtcgacgacgcggagaagtccctccgggtcgagtac
cgctccaaactcctcaacccgaaatggttcgaggggatgctgaagcacggccacagcggc
gctactgaaatcagcaaccgtgtcacctacatgctcggctgggacgccgtgaccaagagc
gttgacgactgggtctataaaaagaccgcggaaacctacgccctcgaccccgagatgcgc
gaacgccttgcgaaggtgaacccgcaggccatcaagaacatcgtcggcaggatgctcgaa
gcccacggccgcggtatgtggtctgccgaccagtcgaccatcgacgagctgcaggagatc
tacgctgatcttgaggaccgcctcgaaggcatgacggatgaggattga

DBGET integrated database retrieval system