KEGG   Pelodictyon luteolum: Plut_0787Help
Entry
Plut_0787         CDS       T00291                                 

Definition
magnesium-chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
plt  Pelodictyon luteolum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:plt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
903323..907150
Genome map
AA seq 1275 aa AA seqDB search
MSQLRKIVAVVGLEQYNAGLWRKIKGLLSGEAELTQLSDVDLEKQHPEAATALREADCVF
MSMIQFKEQVDWFKEQVEAGTPGKTIFVFESMPEAMSLTKVGSYGTGDGKAGMPDMVKKV
AKMLVKGRDEDALYGYMKLMKIMRTILPLVPAKAKDFKNWLLVYSYWMQPTAENIANMFR
LILKEYFNEPVTVGAIVDVPNMGLYHPDAPEYFKDVKSYKSWMKKRGVNMDKGRRIALLF
FRKHLIQEKTYIDNTIRVLEKHGIQLYPAFVTGVEGHVLVRDWLLKEKLDMLVNMMGFGL
VGGPAGSTKPGIAADARHEILSKLDAPYMVAQPLLTQEYESWHELGVSPMQVTFTYSIPE
MDGAVCPVILGALRDGKVETVPERLERLAILVKQWLRLRETANREKKLALIVYDYPPGLG
KKASAALLDVPKTLFAVLQRLKKEGYEVGKLPESSDELFRLLDRATDYQALQNRREALTV
SHERFKELTTAGERERIEERWQSFPGEIVPMGTEELFIGGIRFGNIFIGVQPRIGVQGDP
MRLLFDKSNTPHHQYIAFYRWISREFQAHAMVHVGMHGSAEWMPGLQTGLTGECWPDALC
GEVPHVYIYPINNPSESTIAKRRGLATMVSHVVPPLSRAGLYKELPALKDLLADYRERNP
RGAGDGSDAAGIEEAIMQKAELLNLTDDCPKREGEPFADFVSRLYIYMSELENRLISNSL
HVFGEASPLESQVTTITETLKNRGENGRTLPTILLASSGKNGHFTGYEELAARSRQGDEE
AIRLREWVEQACRQFVEEVLFQHKSASGVFTAITGGSRPAAEDQPFIEQLMGEGAQLLHA
LRDNTGEMESLMKVLNGRYIASGPGGDLVRDGINVLPSGRNIHAIDPWRIPSELAFKRGT
LIADSIVKKHLEENEGRYPETIAQVLWGLDTIKTKGEAVAVVIRLLGGEPAYDAFGKISH
YGLVPLDRLKRPRIDVLMQLSPIFRDAFGLLMDQLDRLLKEAAKADEPEDMNFVRKHVNE
AIAGGATFEGATSRQFTQSPGAYGTYVDDMIEDSAWESEDDLDDLFIRRNSSAYGGERKG
EKETEILKNLLGSVDRVVHQVDSTEFGISDIDHYFSSSGSLQLAARRRNTRATDVKLNYV
ESFTSDIKVDDAEKSLRVEYRSKLLNPKWFEGMLKHGHSGATEISNRVTYMLGWDAVTKS
VDDWVYKKTAETYALDPEMRERLAKVNPQAIKNIVGRMLEAHGRGMWSADQSTIDELQEI
YADLEDRLEGMTDED
NT seq 3828 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacttcgcaaaatcgttgccgttgtagggctcgagcagtacaacgcaggtctc
tggaggaaaatcaaggggctgctctcgggcgaggccgagctgacccagctgagcgacgtg
gatctggaaaagcagcaccccgaggctgcaacggccctccgggaggccgactgcgtgttc
atgagcatgatccagttcaaggaacaggttgactggttcaaggaacaggtagaggccggt
acccccggcaagaccattttcgtgtttgagtcgatgccggaagccatgtccctgacaaag
gtcggcagctacggcaccggggacggcaaggcgggcatgcccgacatggtgaagaaggtg
gccaagatgcttgtgaaaggccgtgacgaggatgccctctacggctacatgaagctgatg
aagatcatgcgaacgatcctcccgctcgtgccggccaaagcgaaggacttcaagaactgg
ctgctggtatactcctactggatgcagccgacggcggagaacatcgccaacatgttccgt
ctcatcctcaaagagtacttcaacgaaccagtcaccgtcggcgccatcgtcgacgtgccg
aacatgggactctaccatcccgacgccccggagtatttcaaggacgtgaaaagctacaag
tcgtggatgaagaagcgcggagtgaacatggacaaggggcgccgtatcgccctgctcttt
ttccgcaagcacctgatccaggaaaagacctatatcgacaacaccatccgtgtgcttgaa
aagcacggcatccagctctatcccgccttcgtgaccggtgtcgagggccatgtgctcgtg
cgtgactggcttttgaaggaaaaactcgacatgctggtcaacatgatggggttcggcctc
gtcggcggccctgcaggctcgaccaagcccggcatcgcagccgatgcccgccacgagatc
ctctcgaagctcgacgccccctacatggtcgcacagccgctccttacccaggagtatgaa
tcatggcacgagctcggtgtctcgccgatgcaggtgaccttcacctactccatccctgag
atggacggtgccgtctgcccggtcatcctcggtgcgctccgtgacggcaaggtggagacc
gtgcccgagcgtcttgagcgcctcgccatcctcgtcaagcagtggcttcgattgagggaa
acggcgaaccgcgagaagaaactcgccctcatcgtctacgactatccgccgggcctcggc
aaaaaagccagtgcagccctgctcgacgtgcccaaaaccctctttgccgtgctccagcgc
ctgaagaaggaggggtacgaggtcggcaagctgccggaaagttctgatgaactgttccgt
ctgctcgaccgcgcaaccgactaccaggccctgcagaacagacgcgaagcgcttacggta
agccatgagcgattcaaggaactgacgacggcgggcgagcgtgagcgcatcgaagagcgc
tggcagtcgttcccgggcgagatcgttccgatgggcaccgaagagctgtttatcggtggc
atccggttcggcaacatcttcatcggcgtccagccgcgcatcggcgtgcagggggacccg
atgcggcttctgttcgacaagtcgaacaccccgcatcaccagtatatcgcgttctaccgc
tggatcagccgcgagttccaggcccacgccatggtgcatgtcggcatgcacggttcggcc
gagtggatgccgggcctgcagacgggcctgaccggagagtgctggccggacgccctctgc
ggcgaggttccgcatgtctacatctatccgatcaacaacccgagcgagtcgaccatcgcc
aaacggcgcggtcttgccaccatggtctcgcacgtcgtgccgccgctttctcgcgcaggc
ctctacaaggagcttccggccctcaaggacctgcttgccgactaccgcgagcgcaacccg
cggggagcgggtgatgggagcgatgcggcaggcatcgaggaggcaatcatgcagaaggcc
gagctgctcaaccttaccgatgactgcccgaagagggagggagagccgttcgccgacttc
gtcagccgcctctacatctacatgagcgaactcgaaaaccgcctcatatccaactcgctg
catgtgttcggcgaggcaagccctcttgagtcgcaggtcaccaccatcaccgaaaccctt
aaaaaccggggtgagaacggccgtaccctgcccaccatcctgctcgcttcttccggaaag
aacggccacttcaccggctacgaagagctggccgcacgttcccgccagggtgacgaagag
gccatccgtctgcgtgaatgggtcgagcaggcctgccggcagttcgtcgaagaggtcctg
ttccagcacaagtcggcttcgggtgtgtttaccgcaatcaccggcggcagccgccctgcc
gctgaggaccagccgttcatcgagcagctgatgggcgagggagcgcagctcctgcatgcc
cttcgtgacaacacgggcgagatggagtcgctcatgaaggtgctcaacggccgctacatc
gcctctggccccggcggcgacctggtgcgcgacggcatcaacgtcctgccgtccggcagg
aacatccatgccatcgacccctggcggatcccttccgagcttgcattcaagcgcgggacc
ctcatcgccgacagcatcgtcaaaaagcaccttgaggagaatgaaggccgctatcctgaa
accatcgcacaggtgctctggggccttgacaccatcaagaccaagggcgaggccgtggcc
gtcgtcatccgcctgctcggcggtgaacccgcttacgacgccttcggcaagatcagccac
tacggcctcgtgccgcttgatcgcctgaagcgccctcgcatcgatgtgctcatgcagctc
agcccgatattccgtgacgcgttcggcctgctcatggaccagctcgaccgcctgttgaaa
gaggctgccaaagccgatgaacccgaggatatgaactttgtccgcaagcacgtcaacgaa
gccatcgcaggaggagcaacgttcgagggcgcgacgtcgcggcagttcacccagtcgccc
ggcgcctacggcacctacgtcgacgacatgattgaagactccgcctgggagtccgaggac
gacctcgacgatctcttcatccgccgcaacagcagcgcctacggcggtgagcgtaaagga
gagaaggagacggaaatcctcaagaacctgctcggctcggtcgaccgtgtagtccatcag
gtcgattccaccgagttcggcatctccgacatcgaccactacttctcatcgtccggctca
ctgcagcttgccgcacggcggcgcaacaccagggcaacggacgtgaagctcaactatgtc
gagtccttcacctccgacatcaaggtcgacgacgcggagaagtccctccgggtcgagtac
cgctccaaactcctcaacccgaaatggttcgaggggatgctgaagcacggccacagcggc
gctactgaaatcagcaaccgtgtcacctacatgctcggctgggacgccgtgaccaagagc
gttgacgactgggtctataaaaagaccgcggaaacctacgccctcgaccccgagatgcgc
gaacgccttgcgaaggtgaacccgcaggccatcaagaacatcgtcggcaggatgctcgaa
gcccacggccgcggtatgtggtctgccgaccagtcgaccatcgacgagctgcaggagatc
tacgctgatcttgaggaccgcctcgaaggcatgacggatgaggattga

DBGET integrated database retrieval system