KEGG   Pelodictyon luteolum: Plut_0811Help
Entry
Plut_0811         CDS       T00291                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
plt  Pelodictyon luteolum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
932399..933514
Genome map
AA seq 371 aa AA seqDB search
MIRPRASMPGLSGMRVAAGALMNLKKLKKHITMNATSRLFAAAAFSVLAACSEGGQTPRS
SSLRSEPVAPVAAARVDDPELVELGRKLYFDPRLSKSGFISCNSCHNLSMGGSDNLKSSI
GHNWSKGPINAPTVLNSSMNLAQFWDGRAKDLQEQAGGPIANPGEMAFTHKLAVDMLLSI
PAYVDEFREVFGAEGIDIKKVTKAIAAFEETLVTPGSRFDFWLKGDDRALSAEELEGYQL
FKSSGCTACHNGPLFGGNSYQKMGVIEPYSAKSPAEGRSAVTGRDADRFNFKVPTLRNVE
LTYPYFHDGEAETLTEAVEVMGRIQLGRTYSESDNRKIVAFLKTLTGKQPEIMLPLLPPS
SDSTPRPTPFE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatccggcccagggcgtccatgcccgggctttccggcatgcgtgttgctgccggcgcg
ctcatgaatttgaaaaaactcaagaagcacatcaccatgaacgcaacgtcacggttgttt
gcggcagcggctttttcagtcctcgcagcctgctccgaggggggacagaccccccggtct
tcctccctccgcagcgaaccggttgcccctgtggctgcagccagggtcgatgaccctgaa
ctcgtagagcttggcaggaagctctatttcgatccgcgtctctcgaagtccgggttcatt
tcctgcaattcctgccacaacctcagcatgggcggcagcgacaacctgaagagctccatc
ggccataactggtcgaaagggccgatcaatgcacccaccgtgctcaactcgagcatgaac
ctcgcacagttctgggacggccgtgccaaagacctgcaggagcaggccggcggcccgatt
gccaaccccggtgaaatggctttcacccacaagctggctgtcgacatgcttctctccata
ccagcctatgtcgatgagttcagggaggtgttcggtgcggagggtattgatatcaagaag
gtcacaaaggccattgcggccttcgaggaaacgctcgttacgcccggctcccgcttcgac
ttctggctcaagggcgacgacagggctctctcagccgaggagctcgaggggtatcagctt
ttcaagtcgagcggctgtacggcatgccataacggcccgctctttggcggcaactcctac
cagaagatgggtgttatcgagccctattcggcaaaaagcccggcagaaggacgctccgcc
gttaccggcagggatgccgaccggttcaacttcaaggtcccgaccctgcgcaatgtggaa
ttgacttatccatacttccacgacggcgaagctgaaaccctcacggaagccgttgaagtg
atgggccgcatccagctcggcagaacctacagcgaaagcgacaaccggaaaatcgtcgcc
ttccttaaaaccctcaccggcaagcagccggaaatcatgctgccgctgcttcctccctcc
agcgacagcacgccccgccccacgcctttcgaataa

DBGET integrated database retrieval system