KEGG   Chlorobium luteolum: Plut_0811Help
Entry
Plut_0811         CDS       T00291                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
plt  Chlorobium luteolum
Brite
Enzymes [BR:plt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Plut_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C DHOR DUF4939
Motif
Other DBs
NCBI-ProteinID: ABB23682
JGI: Plut_0811
UniProt: Q3B4P9
Position
932399..933514
Genome map
AA seq 371 aa AA seqDB search
MIRPRASMPGLSGMRVAAGALMNLKKLKKHITMNATSRLFAAAAFSVLAACSEGGQTPRS
SSLRSEPVAPVAAARVDDPELVELGRKLYFDPRLSKSGFISCNSCHNLSMGGSDNLKSSI
GHNWSKGPINAPTVLNSSMNLAQFWDGRAKDLQEQAGGPIANPGEMAFTHKLAVDMLLSI
PAYVDEFREVFGAEGIDIKKVTKAIAAFEETLVTPGSRFDFWLKGDDRALSAEELEGYQL
FKSSGCTACHNGPLFGGNSYQKMGVIEPYSAKSPAEGRSAVTGRDADRFNFKVPTLRNVE
LTYPYFHDGEAETLTEAVEVMGRIQLGRTYSESDNRKIVAFLKTLTGKQPEIMLPLLPPS
SDSTPRPTPFE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatccggcccagggcgtccatgcccgggctttccggcatgcgtgttgctgccggcgcg
ctcatgaatttgaaaaaactcaagaagcacatcaccatgaacgcaacgtcacggttgttt
gcggcagcggctttttcagtcctcgcagcctgctccgaggggggacagaccccccggtct
tcctccctccgcagcgaaccggttgcccctgtggctgcagccagggtcgatgaccctgaa
ctcgtagagcttggcaggaagctctatttcgatccgcgtctctcgaagtccgggttcatt
tcctgcaattcctgccacaacctcagcatgggcggcagcgacaacctgaagagctccatc
ggccataactggtcgaaagggccgatcaatgcacccaccgtgctcaactcgagcatgaac
ctcgcacagttctgggacggccgtgccaaagacctgcaggagcaggccggcggcccgatt
gccaaccccggtgaaatggctttcacccacaagctggctgtcgacatgcttctctccata
ccagcctatgtcgatgagttcagggaggtgttcggtgcggagggtattgatatcaagaag
gtcacaaaggccattgcggccttcgaggaaacgctcgttacgcccggctcccgcttcgac
ttctggctcaagggcgacgacagggctctctcagccgaggagctcgaggggtatcagctt
ttcaagtcgagcggctgtacggcatgccataacggcccgctctttggcggcaactcctac
cagaagatgggtgttatcgagccctattcggcaaaaagcccggcagaaggacgctccgcc
gttaccggcagggatgccgaccggttcaacttcaaggtcccgaccctgcgcaatgtggaa
ttgacttatccatacttccacgacggcgaagctgaaaccctcacggaagccgttgaagtg
atgggccgcatccagctcggcagaacctacagcgaaagcgacaaccggaaaatcgtcgcc
ttccttaaaaccctcaccggcaagcagccggaaatcatgctgccgctgcttcctccctcc
agcgacagcacgccccgccccacgcctttcgaataa

DBGET integrated database retrieval system