KEGG   Pelodictyon luteolum: Plut_1049Help
Entry
Plut_1049         CDS       T00291                                 

Gene name
argC
Definition
N-acetyl-gamma-glutamyl-phosphate reductase (EC:1.2.1.38)
Orthology
K00145  
N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
plt  Pelodictyon luteolum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Plut_1049 (argC)
   01230 Biosynthesis of amino acids
    Plut_1049 (argC)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Plut_1049 (argC)
Enzymes [BR:plt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     Plut_1049 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1198897..1199925)
Genome map
AA seq 342 aa AA seqDB search
MNASLDGATSGPTVSIIGASGYSGAELTRLILRHPAVRLEHLYAFSQAGKSVSSLYPALG
CDRIYRSYEGETGSDIYFLALPHGEAHAIVPKLQAAGKMVIDLSGDFRLRDTDEHERFYG
GRKSPDAVMTYAMPELSREAIAGARTVSNPGCYATAIILGLAPLFARSSALPRVRSVACT
AISGLSGAGRSSKTELSFAEMSENIRAYKVGVHQHTPEIMQALGTSARNPSFDFSFTPLI
GPLVRGIYATLSVTLDGPVDLKEARSAYEAFYRNAPFTRVRSEMPEVRHVAHTNFCDLHV
AYAGQHGTLTIVSTIDNLLKGAAGQAVENMNIMLGIDETAGL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcttccctggatggggcaacatcgggaccgaccgtctcgatcatcggtgcttcc
gggtattccggcgctgaactcacccggctgattctccgccacccggccgtcagacttgag
cacctctatgcattctcgcaggcaggcaaatccgtttcctccctttaccctgccctcggc
tgtgaccgtatctaccgctcctacgagggcgaaaccggaagcgacatctatttcctcgcg
ctgccgcacggcgaagcgcacgccatagtgccgaagcttcaggccgcaggtaaaatggtc
atagacctgtcaggagacttccgccttcgggacacggatgagcatgagcggttctacggc
ggcaggaaatcccccgatgcggtgatgacctatgccatgccggaactttcccgtgaagcg
atagccggagcccgtaccgtaagcaatcccggatgctacgccacggcgatcattctcggg
ctcgctcccctgtttgcccgctcttcagcactgcctcgggtgcgttctgtcgcctgtacg
gcgatttcgggcctgtcgggtgcaggacggagctccaaaaccgaactttcgtttgccgaa
atgagcgaaaacatcagggcctacaaggtcggagtgcaccagcacacccctgaaatcatg
caggcgctcggcacctcagccagaaacccgtcgttcgacttcagcttcacgccccttatc
ggacctctggtcaggggcatctacgcaaccctctccgtaacgctggacggtccggttgat
ctcaaggaggccaggagcgcctatgaggcattctaccgcaatgcgcccttcacaagagtg
cggagcgaaatgccggaagtgcgccatgtcgcccataccaacttctgcgaccttcatgtt
gcctatgccggacagcacggcaccctcaccattgtatcaaccatcgacaacctcctgaaa
ggagcagccggccaggccgtcgagaacatgaacatcatgctcgggattgatgaaaccgca
gggctttga

DBGET integrated database retrieval system