KEGG   Pelodictyon luteolum: Plut_1061Help
Entry
Plut_1061         CDS       T00291                                 

Definition
citrate lyase subunit 1
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
plt  Pelodictyon luteolum
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plut_1061
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plut_1061
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Plut_1061
Enzymes [BR:plt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Plut_1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1210662..1211858
Genome map
AA seq 398 aa AA seqDB search
MAKILEGPAMKLFNKWGIPVPNYVVIMDPERLMQLGEANKWLRDSKLVVKAHEAIGGRYK
LGLVKIGLNLEEAYEAAKEMIGREIGTAVVRQVIVAEMLEHDAEYYVSIAGNRDGAELLL
SNKGGVDIEDNWDTVKRLFIPLDETPSLEKLTETAADAGFTGEVAERVAKIASRLILCFD
NEDAQSIEINPLVIRKSDMRFAALDAVMNVDWDARFRHADWDFKPVSEIGRPFTEAEQQI
MEIDARIKGSVKFVEVPGGEIALLTAGGGASVFYSDAVVARGGTIANYAEYSGDPADWAV
EALTETICQLPNIKHIIVGGAIANFTDVKATFSGIINGFRASKAKGYLDGVKIWVRRGGP
NENQGLAAIKKLEDEGFDIHVYDRTMPMTDIVDLALKA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatacttgaagggcctgccatgaaactgttcaacaagtggggcattcccgtg
ccgaactatgttgtcatcatggatcccgaacgccttatgcagctcggagaagctaataaa
tggctccgggattcgaaacttgtcgttaaagcacacgaagccataggcggacggtacaag
ctgggccttgtcaagatcggcctgaacctcgaagaggcgtatgaggcagcaaaagaaatg
atcggcagggagatcggcaccgccgtcgtccgtcaggtcatcgtcgcagaaatgcttgag
catgacgcggaatattacgtctcaatcgccggcaaccgcgacggcgctgaactcctgctc
tccaacaagggcggcgtagatatcgaagacaactgggacaccgtcaaaaggcttttcatt
ccccttgacgagaccccttcccttgaaaagctcaccgaaacggcagcggatgccggtttt
accggagaagtcgcagagcgcgtcgccaagatcgcctcacgccttatcctctgcttcgac
aacgaagatgcacagtccatcgaaatcaacccgcttgtcatccgcaagagcgacatgcgc
tttgcagcgcttgacgcggtcatgaacgtcgactgggatgcccgtttccgccatgcggac
tgggatttcaaaccggtttccgaaatcggccgtccgttcaccgaagccgagcagcagatc
atggagattgatgcacgcatcaagggttcggtcaagttcgttgaagttcccggcggcgaa
atcgccctcctgacagcaggcggcggcgcttccgtattctattccgatgcggttgtcgca
cgcggcggcaccatcgccaactatgcagaatactccggcgacccggccgactgggctgtg
gaagcactcacggagaccatctgccagcttccgaacatcaagcacatcatcgtcggtggc
gcaatcgccaacttcaccgatgtgaaagcgacgttcagcggcatcatcaacgggttccgt
gccagcaaggcaaaaggctacctggatggagtgaagatctgggtgaggcgtggcggaccg
aacgagaaccagggtcttgccgccatcaaaaagctcgaagacgaagggttcgacatccat
gtctacgatcgcaccatgccgatgaccgatatcgtcgaccttgcactgaaagcgtaa

DBGET integrated database retrieval system