KEGG   Pelodictyon luteolum: Plut_1108Help
Entry
Plut_1108         CDS       T00291                                 

Definition
heterodisulfide reductase subunit C/succinate dehydrogenase subunit C (EC:1.8.98.1)
Orthology
K03389  
heterodisulfide reductase subunit B [EC:1.8.98.1]
Organism
plt  Pelodictyon luteolum
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plut_1108
  Energy metabolism
   00680 Methane metabolism
    Plut_1108
Enzymes [BR:plt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.98  With other, known, acceptors
    1.8.98.1  CoB---CoM heterodisulfide reductase
     Plut_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1261498..1263006
Genome map
AA seq 502 aa AA seqDB search
MQEKQRLEGERLKQEITEVTGNAFNSCYQCGKCTAGCPAGNLMDNPPTRIMRLVQAGMVE
EALRSDALWYCVGCMTCTSRCPQNMDIAGTMDALRSIALRTGTVSDDKAKKLVTAFHVSF
LNNIKKHGRLQELSLVQSYKLRTRSFLQDAGAGITMLREGKINPLHALTGKEDVKGKDQI
AAIFAAAQKPGSHHTATRKPKKNTFTPGAPISIAPGSTIGYYPGCSLSGTAKEYDISVRK
MCSLLGLTLKEIPDWNCCGATSAHATNHKLSLLLPARNQALADREGMDLVLAPCAACQNR
QVMARRALMEDPELRRELKAATGMEATGNAQFIGVTQLLEALGSEEIAKHVKKPLVSLSL
ACYYGCLLVRPFDAMQFDDPENPMKMEAVLQTLGASTVDWAFKIECCGAGLTLAQQGMVE
DLTYNIARNAQANGAEAFAVACPLCHANLDMRQEGMRKRYGDIKPMPVYYISELVAIACG
ADPVEVAVGKHFVPALDMVSHR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagaaaaacagagacttgaaggcgaacgcctgaagcaggaaatcaccgaggtgacc
ggcaatgcgttcaacagctgctatcagtgcgggaaatgcacagccggctgccctgccggg
aaccttatggacaaccctcccacccggatcatgcgcctcgtacaggccggcatggtcgag
gaggcactcagaagcgatgccctctggtactgcgtcgggtgcatgacatgcacctcccgc
tgccctcagaacatggacattgctggcaccatggacgccctgcgctccatcgccctcaga
accggtacggtatcggatgacaaagccaaaaagctggtcacagcattccatgtctcgttc
ctgaacaatatcaaaaagcacggacggcttcaggaactctccctcgtccagagctataaa
ctccgcacccgcagcttcctgcaggatgccggagccggcatcaccatgctcagggaaggc
aagatcaatccgctccatgcccttacaggcaaagaggatgtcaaaggcaaggatcagatc
gcggcgatatttgccgccgcccaaaagcccggcagccaccatactgcgacgaggaaaccc
aaaaaaaacacgttcactcccggagctcccatttcgatagcccccggctcgaccatcgga
tactatcccggctgctccctcagcggaactgcgaaggagtatgacatctccgtacggaaa
atgtgttcgcttctcggcctgacgctgaaggaaatccctgactggaactgctgcggtgcc
acttcggcgcatgccacgaaccacaaactctccctcctgcttccagcacgtaaccaggca
ttggcggacagggaggggatggatcttgtgctggcaccctgtgcggcatgccagaaccgt
caggtcatggcacgacgtgcactcatggaagacccggagctccggcgcgagctgaaggcg
gcaaccggtatggaggcaacaggcaatgcccagttcatcggcgtaacccagctgctcgaa
gcccttggttcggaagagatcgcaaaacatgtgaagaaaccgctggtttcgctttccctt
gcctgttactacgggtgcctgcttgtcaggccttttgatgccatgcagtttgacgaccct
gaaaacccgatgaaaatggaggctgtcctccagactctcggagcctccaccgtcgactgg
gctttcaagatcgagtgctgcggtgcgggcctcaccctggcccagcagggcatggtggag
gacctcacctacaacattgcaaggaatgcacaggcgaacggcgctgaagcctttgctgtc
gcctgcccgctctgccacgccaacctcgatatgcgccaggaaggcatgagaaaacgctac
ggggacatcaaaccaatgccggtgtactatatttccgaactggtagccatcgcctgcggt
gccgatcccgtggaagtagccgtcggcaagcattttgtccccgcactggacatggtctca
caccgataa

DBGET integrated database retrieval system