KEGG   Chlorobium luteolum: Plut_1284Help
Entry
Plut_1284         CDS       T00291                                 

Definition
(GenBank) RecR protein
  KO
K06187  
recombination protein RecR
Organism
plt  Chlorobium luteolum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:plt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Plut_1284
DNA repair and recombination proteins [BR:plt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Plut_1284
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Plut_1284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1452520..1453134)
Genome map
AA seq 204 aa AA seqDB search
MQYSSSSIEALIDAFSRLPGVGRKTARRLAMYVLQQPRLEAERLARALIDVKDRVIRCSV
CQNVTDREEDPCSICTSQGRDRTVICVVESPVDVLAFEKTGHYRGLYHVLHGVISPLDGV
GPDDIKIRELLGRLSPEGIGGVREIVLALNPTIEGETTSLYLSRLLKPLGVEVTKIARGI
PVGAELEFIDEATLSRAMEGRSAV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacagctcatcctcaatagaagccctgattgacgctttctcgcgtcttccgggc
gtgggccgcaaaaccgcccgtcgccttgccatgtacgttctgcagcagccgcggcttgag
gccgagcggcttgcccgggcgctcattgatgtgaaagacagggtgatccgctgttcggtg
tgccagaacgtgaccgaccgcgaagaggatccctgctcaatctgcaccagccaggggcgt
gaccggacggtcatctgcgtcgtcgagtcgccggtcgacgttctcgcgtttgaaaagacc
gggcactaccggggcctctaccatgtgctgcacggtgtgatctccccgctggacggggtc
ggaccggacgacataaagatccgcgaactgctcggccggctttcacccgaagggatcgga
ggcgttcgtgaaatcgtgcttgccctgaaccccacgattgagggcgagacgacatccctc
tatctcagccggctgctcaagccgctgggggtggaggttacaaagattgccagaggcatc
cctgtcggtgccgaacttgaattcattgacgaagccaccctttcccgggccatggaaggc
cgctcggcggtctaa

DBGET integrated database retrieval system