KEGG   Pelodictyon luteolum: Plut_1464Help
Entry
Plut_1464         CDS       T00291                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
plt  Pelodictyon luteolum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plut_1464 (tpiA)
   01230 Biosynthesis of amino acids
    Plut_1464 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plut_1464 (tpiA)
   00051 Fructose and mannose metabolism
    Plut_1464 (tpiA)
   00562 Inositol phosphate metabolism
    Plut_1464 (tpiA)
Enzymes [BR:plt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Plut_1464 (tpiA)
Exosome [BR:plt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Plut_1464 (tpiA)
  Exosomal proteins of bladder cancer cells
   Plut_1464 (tpiA)
  Exosomal proteins of melanoma cells
   Plut_1464 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1649418..1650170)
Genome map
AA seq 250 aa AA seqDB search
MRRKIVVGNWKMNKTVAESTALATAVIAALGDGCSACEAGIAPTYPALDAVGRALEGSGI
ALVAQNCHYEDDGAYTGEVSTGMLKAVGCSYVIIGHSERRQYFGETDETVNLRIKKVLAS
GMKVILCVGETLAEREEGVTGTVVSRQVTEGLKGVADITDLVIAYEPVWAIGTGKTASSD
QAQEVHRLIRDTVKGMYGAEVSEAVRIQYGGSVKASNAEELFAMPDIDGGLIGGASLNAA
DFAAIVKAGC
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaaaaatcgttgtcggcaactggaaaatgaacaaaacggtcgcagagtcgact
gcacttgccacggcggtcatcgctgcgcttggtgacgggtgttcggcctgcgaggccggc
attgccccgacctatcccgcacttgacgccgtcgggcgtgctttagagggcagcggcatc
gcgcttgtggcccagaactgtcactatgaagacgacggggcatacaccggagaggtctca
accggcatgttgaaggcagtcggctgcagctacgtcatcatcggccactccgagcgccgc
cagtatttcggggagacggacgagaccgtcaatctccgcatcaagaaagtgctcgcttcc
ggcatgaaggttatcctctgcgtcggcgaaacgcttgctgagcgtgaagaaggggtaacc
ggcaccgtggtttcacggcaggtgaccgaggggctgaaaggcgttgcagacattaccgat
ctcgtgatcgcctatgagccggtatgggccatcggaacaggcaagaccgcttcttccgat
caggctcaggaagtccaccgcctgatccgtgatacggtgaagggaatgtacggcgctgaa
gtctccgaggccgtgcgcatccagtacggtggaagcgtcaaggcttcaaacgccgaggaa
ctcttcgccatgccggacatcgacggcggacttatcggaggtgccagcctcaacgctgct
gatttcgcagccatcgtcaaggctggctgctga

DBGET integrated database retrieval system