KEGG   Pelodictyon luteolum: Plut_1600Help
Entry
Plut_1600         CDS       T00291                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
plt  Pelodictyon luteolum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:plt01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:plt01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:plt00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:plt00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:plt00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:plt00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:plt00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1792303..1793508
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVLKGAALMAEAKGLELFVIPNGYAGLYNLIDQESLVRLDQQR
LDKFDATFAGSEAGHSRVKIKAISNPEKYNRIKAGMKKFDLDGLVISGGDDSGSVMVDLN
QNGVQCIHAPKTMDLDLQTYSVGGDSTINRITEFVHDLKTTGKTHNRVLVTEVFGRYAGH
TAFRSGVAAEADCILIPEIPADWDVVYQHLAERFTRRIRQSDVHSGTYTIVVAEGLKNAD
GSDIVDESAGIDAFGHKKLAGAGKFTCQEIQKRMKADPAMPLFMKETGMFVEGIYEIPEV
REIHPGHLVRCGSSSAYDTNFGFEAGAAAVLLLLDGKTGVTVSKVKGRKVEYIESEKAIV
QRHVDLEQVAMYEALGICFGRKPVEYDPIMREVEGVYERIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattggcattctaacgagcggcggcgactgcggtggactcaacgcggtcctg
aaaggcgctgccctcatggcagaagcgaaaggccttgaactcttcgtcattcccaacggc
tacgcaggcctttacaacctcatagaccaggagagccttgtccggctcgatcagcagcgc
ctcgacaagttcgatgcaaccttcgccggttcagaagccggccactcccgggtgaagatc
aaggcgatcagcaaccccgagaagtacaaccgcatcaaggccggcatgaagaaattcgac
ctcgacggcctcgtcatcagcggcggagacgactccggcagcgtcatggttgacctcaac
cagaacggcgtccagtgcatccatgcaccaaaaacaatggatctcgacctccagacctac
tcggtcggcggcgactccaccatcaacagaatcaccgagttcgtccacgacctgaaaacc
acgggcaagacccacaaccgggtactggtcaccgaggtcttcggacgctatgcgggccac
acggcattccgcagcggcgttgccgctgaagcggactgcatcctcatccctgaaattccc
gctgactgggacgtggtctaccagcacctcgctgagcgcttcacccgcaggatccgccag
agcgatgtgcacagcggaacctacaccatcgtcgtcgccgaaggcctcaagaatgcagac
ggaagcgacattgtcgacgagtctgcaggcatcgatgcgttcgggcacaagaaactggcc
ggagctggcaagttcacctgccaggagatccagaagcggatgaaagcagacccggcaatg
ccgctcttcatgaaagagaccggcatgttcgtcgaaggaatctacgagatccccgaggtt
cgcgaaatccatcccggccaccttgtccgctgcggaagctcctcggcctacgacaccaac
ttcgggttcgaagccggagccgccgcagtcctgctcctcctcgatggcaaaaccggtgtg
accgtttcaaaggtaaagggccgcaaggtcgagtacattgaatcggaaaaagccatcgtg
cagcgccatgtcgacctcgaacaggtcgccatgtacgaggcactcggcatctgcttcggc
cgcaagccggttgagtacgatccgatcatgcgcgaagtcgagggcgtctacgaaaggatc
tactga

DBGET integrated database retrieval system