KEGG   Chlorobium luteolum: Plut_1600Help
Entry
Plut_1600         CDS       T00291                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
plt  Chlorobium luteolum
Pathway
plt00010  Glycolysis / Gluconeogenesis
plt00030  Pentose phosphate pathway
plt00051  Fructose and mannose metabolism
plt00052  Galactose metabolism
plt00680  Methane metabolism
plt01100  Metabolic pathways
plt01110  Biosynthesis of secondary metabolites
plt01120  Microbial metabolism in diverse environments
plt01130  Biosynthesis of antibiotics
plt01200  Carbon metabolism
plt01230  Biosynthesis of amino acids
plt03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plut_1600
   00030 Pentose phosphate pathway
    Plut_1600
   00051 Fructose and mannose metabolism
    Plut_1600
   00052 Galactose metabolism
    Plut_1600
  Energy metabolism
   00680 Methane metabolism
    Plut_1600
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Plut_1600
Enzymes [BR:plt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Plut_1600
Protein phosphatases and associated proteins [BR:plt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Plut_1600
Messenger RNA biogenesis [BR:plt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Plut_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Glyco_hydro_49
Motif
Other DBs
NCBI-ProteinID: ABB24454
JGI: Plut_1600
UniProt: Q3B2H7
Position
1792303..1793508
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVLKGAALMAEAKGLELFVIPNGYAGLYNLIDQESLVRLDQQR
LDKFDATFAGSEAGHSRVKIKAISNPEKYNRIKAGMKKFDLDGLVISGGDDSGSVMVDLN
QNGVQCIHAPKTMDLDLQTYSVGGDSTINRITEFVHDLKTTGKTHNRVLVTEVFGRYAGH
TAFRSGVAAEADCILIPEIPADWDVVYQHLAERFTRRIRQSDVHSGTYTIVVAEGLKNAD
GSDIVDESAGIDAFGHKKLAGAGKFTCQEIQKRMKADPAMPLFMKETGMFVEGIYEIPEV
REIHPGHLVRCGSSSAYDTNFGFEAGAAAVLLLLDGKTGVTVSKVKGRKVEYIESEKAIV
QRHVDLEQVAMYEALGICFGRKPVEYDPIMREVEGVYERIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattggcattctaacgagcggcggcgactgcggtggactcaacgcggtcctg
aaaggcgctgccctcatggcagaagcgaaaggccttgaactcttcgtcattcccaacggc
tacgcaggcctttacaacctcatagaccaggagagccttgtccggctcgatcagcagcgc
ctcgacaagttcgatgcaaccttcgccggttcagaagccggccactcccgggtgaagatc
aaggcgatcagcaaccccgagaagtacaaccgcatcaaggccggcatgaagaaattcgac
ctcgacggcctcgtcatcagcggcggagacgactccggcagcgtcatggttgacctcaac
cagaacggcgtccagtgcatccatgcaccaaaaacaatggatctcgacctccagacctac
tcggtcggcggcgactccaccatcaacagaatcaccgagttcgtccacgacctgaaaacc
acgggcaagacccacaaccgggtactggtcaccgaggtcttcggacgctatgcgggccac
acggcattccgcagcggcgttgccgctgaagcggactgcatcctcatccctgaaattccc
gctgactgggacgtggtctaccagcacctcgctgagcgcttcacccgcaggatccgccag
agcgatgtgcacagcggaacctacaccatcgtcgtcgccgaaggcctcaagaatgcagac
ggaagcgacattgtcgacgagtctgcaggcatcgatgcgttcgggcacaagaaactggcc
ggagctggcaagttcacctgccaggagatccagaagcggatgaaagcagacccggcaatg
ccgctcttcatgaaagagaccggcatgttcgtcgaaggaatctacgagatccccgaggtt
cgcgaaatccatcccggccaccttgtccgctgcggaagctcctcggcctacgacaccaac
ttcgggttcgaagccggagccgccgcagtcctgctcctcctcgatggcaaaaccggtgtg
accgtttcaaaggtaaagggccgcaaggtcgagtacattgaatcggaaaaagccatcgtg
cagcgccatgtcgacctcgaacaggtcgccatgtacgaggcactcggcatctgcttcggc
cgcaagccggttgagtacgatccgatcatgcgcgaagtcgagggcgtctacgaaaggatc
tactga

DBGET integrated database retrieval system