KEGG   Pelodictyon luteolum: Plut_1600Help
Entry
Plut_1600         CDS       T00291                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
plt  Pelodictyon luteolum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plut_1600
   01230 Biosynthesis of amino acids
    Plut_1600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plut_1600
   00030 Pentose phosphate pathway
    Plut_1600
   00051 Fructose and mannose metabolism
    Plut_1600
   00052 Galactose metabolism
    Plut_1600
  Energy metabolism
   00680 Methane metabolism
    Plut_1600
Enzymes [BR:plt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Plut_1600
Protein phosphatases and associated proteins [BR:plt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Plut_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1792303..1793508
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVLKGAALMAEAKGLELFVIPNGYAGLYNLIDQESLVRLDQQR
LDKFDATFAGSEAGHSRVKIKAISNPEKYNRIKAGMKKFDLDGLVISGGDDSGSVMVDLN
QNGVQCIHAPKTMDLDLQTYSVGGDSTINRITEFVHDLKTTGKTHNRVLVTEVFGRYAGH
TAFRSGVAAEADCILIPEIPADWDVVYQHLAERFTRRIRQSDVHSGTYTIVVAEGLKNAD
GSDIVDESAGIDAFGHKKLAGAGKFTCQEIQKRMKADPAMPLFMKETGMFVEGIYEIPEV
REIHPGHLVRCGSSSAYDTNFGFEAGAAAVLLLLDGKTGVTVSKVKGRKVEYIESEKAIV
QRHVDLEQVAMYEALGICFGRKPVEYDPIMREVEGVYERIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattggcattctaacgagcggcggcgactgcggtggactcaacgcggtcctg
aaaggcgctgccctcatggcagaagcgaaaggccttgaactcttcgtcattcccaacggc
tacgcaggcctttacaacctcatagaccaggagagccttgtccggctcgatcagcagcgc
ctcgacaagttcgatgcaaccttcgccggttcagaagccggccactcccgggtgaagatc
aaggcgatcagcaaccccgagaagtacaaccgcatcaaggccggcatgaagaaattcgac
ctcgacggcctcgtcatcagcggcggagacgactccggcagcgtcatggttgacctcaac
cagaacggcgtccagtgcatccatgcaccaaaaacaatggatctcgacctccagacctac
tcggtcggcggcgactccaccatcaacagaatcaccgagttcgtccacgacctgaaaacc
acgggcaagacccacaaccgggtactggtcaccgaggtcttcggacgctatgcgggccac
acggcattccgcagcggcgttgccgctgaagcggactgcatcctcatccctgaaattccc
gctgactgggacgtggtctaccagcacctcgctgagcgcttcacccgcaggatccgccag
agcgatgtgcacagcggaacctacaccatcgtcgtcgccgaaggcctcaagaatgcagac
ggaagcgacattgtcgacgagtctgcaggcatcgatgcgttcgggcacaagaaactggcc
ggagctggcaagttcacctgccaggagatccagaagcggatgaaagcagacccggcaatg
ccgctcttcatgaaagagaccggcatgttcgtcgaaggaatctacgagatccccgaggtt
cgcgaaatccatcccggccaccttgtccgctgcggaagctcctcggcctacgacaccaac
ttcgggttcgaagccggagccgccgcagtcctgctcctcctcgatggcaaaaccggtgtg
accgtttcaaaggtaaagggccgcaaggtcgagtacattgaatcggaaaaagccatcgtg
cagcgccatgtcgacctcgaacaggtcgccatgtacgaggcactcggcatctgcttcggc
cgcaagccggttgagtacgatccgatcatgcgcgaagtcgagggcgtctacgaaaggatc
tactga

DBGET integrated database retrieval system