KEGG   Pelodictyon luteolum: Plut_1637Help
Entry
Plut_1637         CDS       T00291                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
plt  Pelodictyon luteolum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plut_1637
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plut_1637
   00620 Pyruvate metabolism
    Plut_1637
   00640 Propanoate metabolism
    Plut_1637
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Plut_1637
   00680 Methane metabolism
    Plut_1637
Enzymes [BR:plt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Plut_1637
Lipid biosynthesis proteins [BR:plt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Plut_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1837242..1839245
Genome map
AA seq 667 aa AA seqDB search
MATDDKKTATGQAASSSPANDKISSVLSEKRKFPPPAAFSTNARIKSMEEYEKLYSDAEK
DPDAYWGGLAEEFHWFKKWDTVLEWNTPYAKWFQGGTTNICYNAVDVHANSWRKNKAAII
WEGEEGEQRVLTYGELHRQVSKFANVLKIAGIKPGDRVGIYMGMVPELVIAVLACARVGA
VHNVIFAGFSAHAITERVNDSRAKLLICCDGTRRRGGSINLKNIVDEAIVNTPSIRSVIV
LKVTGENISMHDGMDHWWHDLMGLASDESEPVEVESEHPLFVLYTSGSTGKPKGILHTTA
GYMVHAASSFRYVFDIRDDDIYWCTADVGWITGHSYMVYGPLLNGATLLMYEGAPNYPQW
DRFWDIINRHKVTILYTAPTAIRAFIRAGDEWVTKHNLSSLRLLGTVGEPINPEAWMWYH
KVVGQEKCPIVDTWWQTETGGIMVSPLPGATPTKPGTATRPLPGIMADVVQKDGTPCGPN
EGGYLVIKKPWPSMLRTIYGDNKRYEETYWSEFHDMYFTGDGARKDEDGYIWIMGRVDDV
VNVSGHRLGTSEVESALVSYEAVAEAAVVSRPDDIKGNALVAFVTLKDEYEGDMKLREAL
RNHVAKEIGPIAKPDEIRWAKGLPKTRSGKIMRRLLRELATSNEIKGDVTTLEDFGVLEN
LREKEED
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggctacagacgacaaaaaaacagcaacggggcaggccgcctcatcgtctcccgcaaac
gacaaaatcagctccgtcctgtctgaaaagcgcaagttcccgcctccggccgctttttcc
acaaatgcccggatcaagtcgatggaagagtacgaaaagctctacagtgacgcagaaaaa
gaccccgacgcctactggggcggtctggccgaagagttccactggttcaagaaatgggac
actgtccttgagtggaacaccccctacgcaaaatggttccagggcggcacgacgaacatc
tgctataacgccgtcgacgtgcacgcaaacagctggcgcaagaacaaggctgccatcatt
tgggagggcgaagagggagagcagcgcgttctgacgtacggcgaactccaccgccaggtt
tcgaaattcgccaacgtcctgaagatcgccggcatcaaacccggtgaccgtgtcggcatc
tacatgggcatggtacccgaactggtcatcgcagttcttgcatgcgcaagggtcggcgca
gtccacaatgtcattttcgcaggcttctcggcccacgccatcaccgagcgtgtcaacgac
tcccgtgctaaactgctcatctgctgcgacggaacccggcgccgcggaggctccatcaac
ctcaagaacatcgtcgacgaagccatcgtcaacaccccgtcgatccgcagcgtcatcgtc
ctgaaggtcactggggagaatatcagcatgcacgacggtatggaccattggtggcatgac
ctcatggggctcgcctccgacgagtcggaacccgtcgaggttgaatccgaacacccgctt
ttcgtgctctacacgagcggctcgaccggcaagcccaaaggcatactgcacaccacggcg
ggctacatggtccacgccgccagctctttccgctacgtcttcgacatccgcgacgacgac
atctactggtgcacggcagacgtcgggtggatcaccggtcacagctacatggtatacggc
ccgctgctcaacggcgcgaccctcctcatgtacgaaggcgcaccgaactatccccagtgg
gatcgcttctgggacatcatcaaccgccacaaggtcaccatcctctacacggccccgacc
gccatccgcgccttcatccgcgccggcgacgaatgggtgaccaagcacaacctcagctcg
ctgcgcctgctcggcacggtcggtgaacccatcaaccccgaagcctggatgtggtaccac
aaggtggtcggacaggaaaaatgcccgatcgtcgacacctggtggcagaccgagaccggc
ggcatcatggtctctccgcttcccggcgcgaccccgaccaaacccggtaccgcaacccgc
ccgcttcccggcatcatggccgacgtcgtgcagaaagacggcacaccctgcggcccgaac
gagggcggctacctggtcatcaagaagccctggccgtccatgctccgcaccatctacggt
gacaacaagcgttacgaggagacctactggtcggagttccacgacatgtacttcaccggt
gacggtgcccgcaaggacgaggacggctatatctggatcatgggccgcgtcgatgacgtg
gtgaacgtcagcggccaccgcctcggcacaagcgaggtcgaaagcgcgctcgtctcatac
gaggccgtcgccgaagcagccgtggtcagccgccccgacgacatcaagggcaacgcactt
gtcgcattcgtcaccctgaaggacgagtacgaaggcgacatgaaactgcgcgaagcgctc
cgcaaccacgtagccaaggagatcggtcccatcgccaagccggatgagatccgctgggca
aaaggactgccgaagacccgcagcggcaagatcatgcgccgcctgctccgcgagctggca
acgagcaacgagatcaagggcgacgtcacgacgctcgaagacttcggtgtactcgaaaac
ctccgcgagaaggaagaggattga

  All links  
No link information was found.   
DBGET integrated database retrieval system