KEGG   Pelodictyon luteolum: Plut_1637Help
Entry
Plut_1637         CDS       T00291                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
plt  Pelodictyon luteolum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:plt01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:plt00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:plt00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:plt00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:plt00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:plt00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1837242..1839245
Genome map
AA seq 667 aa AA seqDB search
MATDDKKTATGQAASSSPANDKISSVLSEKRKFPPPAAFSTNARIKSMEEYEKLYSDAEK
DPDAYWGGLAEEFHWFKKWDTVLEWNTPYAKWFQGGTTNICYNAVDVHANSWRKNKAAII
WEGEEGEQRVLTYGELHRQVSKFANVLKIAGIKPGDRVGIYMGMVPELVIAVLACARVGA
VHNVIFAGFSAHAITERVNDSRAKLLICCDGTRRRGGSINLKNIVDEAIVNTPSIRSVIV
LKVTGENISMHDGMDHWWHDLMGLASDESEPVEVESEHPLFVLYTSGSTGKPKGILHTTA
GYMVHAASSFRYVFDIRDDDIYWCTADVGWITGHSYMVYGPLLNGATLLMYEGAPNYPQW
DRFWDIINRHKVTILYTAPTAIRAFIRAGDEWVTKHNLSSLRLLGTVGEPINPEAWMWYH
KVVGQEKCPIVDTWWQTETGGIMVSPLPGATPTKPGTATRPLPGIMADVVQKDGTPCGPN
EGGYLVIKKPWPSMLRTIYGDNKRYEETYWSEFHDMYFTGDGARKDEDGYIWIMGRVDDV
VNVSGHRLGTSEVESALVSYEAVAEAAVVSRPDDIKGNALVAFVTLKDEYEGDMKLREAL
RNHVAKEIGPIAKPDEIRWAKGLPKTRSGKIMRRLLRELATSNEIKGDVTTLEDFGVLEN
LREKEED
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggctacagacgacaaaaaaacagcaacggggcaggccgcctcatcgtctcccgcaaac
gacaaaatcagctccgtcctgtctgaaaagcgcaagttcccgcctccggccgctttttcc
acaaatgcccggatcaagtcgatggaagagtacgaaaagctctacagtgacgcagaaaaa
gaccccgacgcctactggggcggtctggccgaagagttccactggttcaagaaatgggac
actgtccttgagtggaacaccccctacgcaaaatggttccagggcggcacgacgaacatc
tgctataacgccgtcgacgtgcacgcaaacagctggcgcaagaacaaggctgccatcatt
tgggagggcgaagagggagagcagcgcgttctgacgtacggcgaactccaccgccaggtt
tcgaaattcgccaacgtcctgaagatcgccggcatcaaacccggtgaccgtgtcggcatc
tacatgggcatggtacccgaactggtcatcgcagttcttgcatgcgcaagggtcggcgca
gtccacaatgtcattttcgcaggcttctcggcccacgccatcaccgagcgtgtcaacgac
tcccgtgctaaactgctcatctgctgcgacggaacccggcgccgcggaggctccatcaac
ctcaagaacatcgtcgacgaagccatcgtcaacaccccgtcgatccgcagcgtcatcgtc
ctgaaggtcactggggagaatatcagcatgcacgacggtatggaccattggtggcatgac
ctcatggggctcgcctccgacgagtcggaacccgtcgaggttgaatccgaacacccgctt
ttcgtgctctacacgagcggctcgaccggcaagcccaaaggcatactgcacaccacggcg
ggctacatggtccacgccgccagctctttccgctacgtcttcgacatccgcgacgacgac
atctactggtgcacggcagacgtcgggtggatcaccggtcacagctacatggtatacggc
ccgctgctcaacggcgcgaccctcctcatgtacgaaggcgcaccgaactatccccagtgg
gatcgcttctgggacatcatcaaccgccacaaggtcaccatcctctacacggccccgacc
gccatccgcgccttcatccgcgccggcgacgaatgggtgaccaagcacaacctcagctcg
ctgcgcctgctcggcacggtcggtgaacccatcaaccccgaagcctggatgtggtaccac
aaggtggtcggacaggaaaaatgcccgatcgtcgacacctggtggcagaccgagaccggc
ggcatcatggtctctccgcttcccggcgcgaccccgaccaaacccggtaccgcaacccgc
ccgcttcccggcatcatggccgacgtcgtgcagaaagacggcacaccctgcggcccgaac
gagggcggctacctggtcatcaagaagccctggccgtccatgctccgcaccatctacggt
gacaacaagcgttacgaggagacctactggtcggagttccacgacatgtacttcaccggt
gacggtgcccgcaaggacgaggacggctatatctggatcatgggccgcgtcgatgacgtg
gtgaacgtcagcggccaccgcctcggcacaagcgaggtcgaaagcgcgctcgtctcatac
gaggccgtcgccgaagcagccgtggtcagccgccccgacgacatcaagggcaacgcactt
gtcgcattcgtcaccctgaaggacgagtacgaaggcgacatgaaactgcgcgaagcgctc
cgcaaccacgtagccaaggagatcggtcccatcgccaagccggatgagatccgctgggca
aaaggactgccgaagacccgcagcggcaagatcatgcgccgcctgctccgcgagctggca
acgagcaacgagatcaagggcgacgtcacgacgctcgaagacttcggtgtactcgaaaac
ctccgcgagaaggaagaggattga

DBGET integrated database retrieval system