KEGG   Pelodictyon luteolum: Plut_1637Help
Entry
Plut_1637         CDS       T00291                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
plt  Pelodictyon luteolum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plut_1637
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plut_1637
   00620 Pyruvate metabolism
    Plut_1637
   00640 Propanoate metabolism
    Plut_1637
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Plut_1637
   00680 Methane metabolism
    Plut_1637
Enzymes [BR:plt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Plut_1637
Lipid biosynthesis proteins [BR:plt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Plut_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1837242..1839245
Genome map
AA seq 667 aa AA seqDB search
MATDDKKTATGQAASSSPANDKISSVLSEKRKFPPPAAFSTNARIKSMEEYEKLYSDAEK
DPDAYWGGLAEEFHWFKKWDTVLEWNTPYAKWFQGGTTNICYNAVDVHANSWRKNKAAII
WEGEEGEQRVLTYGELHRQVSKFANVLKIAGIKPGDRVGIYMGMVPELVIAVLACARVGA
VHNVIFAGFSAHAITERVNDSRAKLLICCDGTRRRGGSINLKNIVDEAIVNTPSIRSVIV
LKVTGENISMHDGMDHWWHDLMGLASDESEPVEVESEHPLFVLYTSGSTGKPKGILHTTA
GYMVHAASSFRYVFDIRDDDIYWCTADVGWITGHSYMVYGPLLNGATLLMYEGAPNYPQW
DRFWDIINRHKVTILYTAPTAIRAFIRAGDEWVTKHNLSSLRLLGTVGEPINPEAWMWYH
KVVGQEKCPIVDTWWQTETGGIMVSPLPGATPTKPGTATRPLPGIMADVVQKDGTPCGPN
EGGYLVIKKPWPSMLRTIYGDNKRYEETYWSEFHDMYFTGDGARKDEDGYIWIMGRVDDV
VNVSGHRLGTSEVESALVSYEAVAEAAVVSRPDDIKGNALVAFVTLKDEYEGDMKLREAL
RNHVAKEIGPIAKPDEIRWAKGLPKTRSGKIMRRLLRELATSNEIKGDVTTLEDFGVLEN
LREKEED
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggctacagacgacaaaaaaacagcaacggggcaggccgcctcatcgtctcccgcaaac
gacaaaatcagctccgtcctgtctgaaaagcgcaagttcccgcctccggccgctttttcc
acaaatgcccggatcaagtcgatggaagagtacgaaaagctctacagtgacgcagaaaaa
gaccccgacgcctactggggcggtctggccgaagagttccactggttcaagaaatgggac
actgtccttgagtggaacaccccctacgcaaaatggttccagggcggcacgacgaacatc
tgctataacgccgtcgacgtgcacgcaaacagctggcgcaagaacaaggctgccatcatt
tgggagggcgaagagggagagcagcgcgttctgacgtacggcgaactccaccgccaggtt
tcgaaattcgccaacgtcctgaagatcgccggcatcaaacccggtgaccgtgtcggcatc
tacatgggcatggtacccgaactggtcatcgcagttcttgcatgcgcaagggtcggcgca
gtccacaatgtcattttcgcaggcttctcggcccacgccatcaccgagcgtgtcaacgac
tcccgtgctaaactgctcatctgctgcgacggaacccggcgccgcggaggctccatcaac
ctcaagaacatcgtcgacgaagccatcgtcaacaccccgtcgatccgcagcgtcatcgtc
ctgaaggtcactggggagaatatcagcatgcacgacggtatggaccattggtggcatgac
ctcatggggctcgcctccgacgagtcggaacccgtcgaggttgaatccgaacacccgctt
ttcgtgctctacacgagcggctcgaccggcaagcccaaaggcatactgcacaccacggcg
ggctacatggtccacgccgccagctctttccgctacgtcttcgacatccgcgacgacgac
atctactggtgcacggcagacgtcgggtggatcaccggtcacagctacatggtatacggc
ccgctgctcaacggcgcgaccctcctcatgtacgaaggcgcaccgaactatccccagtgg
gatcgcttctgggacatcatcaaccgccacaaggtcaccatcctctacacggccccgacc
gccatccgcgccttcatccgcgccggcgacgaatgggtgaccaagcacaacctcagctcg
ctgcgcctgctcggcacggtcggtgaacccatcaaccccgaagcctggatgtggtaccac
aaggtggtcggacaggaaaaatgcccgatcgtcgacacctggtggcagaccgagaccggc
ggcatcatggtctctccgcttcccggcgcgaccccgaccaaacccggtaccgcaacccgc
ccgcttcccggcatcatggccgacgtcgtgcagaaagacggcacaccctgcggcccgaac
gagggcggctacctggtcatcaagaagccctggccgtccatgctccgcaccatctacggt
gacaacaagcgttacgaggagacctactggtcggagttccacgacatgtacttcaccggt
gacggtgcccgcaaggacgaggacggctatatctggatcatgggccgcgtcgatgacgtg
gtgaacgtcagcggccaccgcctcggcacaagcgaggtcgaaagcgcgctcgtctcatac
gaggccgtcgccgaagcagccgtggtcagccgccccgacgacatcaagggcaacgcactt
gtcgcattcgtcaccctgaaggacgagtacgaaggcgacatgaaactgcgcgaagcgctc
cgcaaccacgtagccaaggagatcggtcccatcgccaagccggatgagatccgctgggca
aaaggactgccgaagacccgcagcggcaagatcatgcgccgcctgctccgcgagctggca
acgagcaacgagatcaagggcgacgtcacgacgctcgaagacttcggtgtactcgaaaac
ctccgcgagaaggaagaggattga

DBGET integrated database retrieval system