KEGG   Pelodictyon luteolum: Plut_1676Help
Entry
Plut_1676         CDS       T00291                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
plt  Pelodictyon luteolum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:plt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1880481..1881392
Genome map
AA seq 303 aa AA seqDB search
MSPHRPAGTTPPLKCRTRTLDFSEGPKVMGILNTTPDSFHDGGTLTGPEGELDLGLALER
ARRMLSEGADIIDIGGESSRPGARVISTDEEIQRTAPLIELVRRESDAPISIDTYKAAVA
EAALQAGADIVNDISGFSFDSAMPSVCNSYGAAAVLMHTPARPADMQWSTRTPNGSEDIT
ATVMHYLEEAVRRAEAAGVQDIIIDPGFGFGKSVEENFRLLKRLGEFRSTKRPVLAGLSN
KSFLAHIAASGGKPVRPTAERLSATLAAETLAVLNGADIIRTHDAGGAKTCIRVVQAMVG
LHG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagccctcatcgcccagccggcaccaccccgccgctcaagtgccgaacgagaacgctt
gatttttccgaagggccgaaagtcatgggcatcctcaacaccacccccgactcgttccac
gacggcgggaccctcaccggcccagagggagaactcgacctcggccttgccctcgaacgc
gcccgcaggatgctcagtgaaggagcggacatcatcgacatcggcggcgaatcctcccgg
cccggcgccagggtaatcagcaccgatgaagagatccagcgcaccgcgccactcatcgag
ctcgtgcgcagggagagcgatgccccgatctcaattgacacctataaagcggcggtggcc
gaggcggcactgcaggccggagccgatatcgtcaacgacatctccgggttctcgttcgac
agcgccatgccctccgtctgcaacagctacggggctgcagcggtcctcatgcacacgccg
gcaaggcctgcagacatgcagtggagcacccggacaccgaacggcagtgaagacatcacc
gccaccgtcatgcactatctcgaagaggccgtgcggcgcgccgaagcagcaggggtacag
gacatcatcatcgaccccgggttcgggttcggcaaaagcgtagaagagaacttcaggctt
ctcaagcggctcggggagttccgctcgacaaagagaccggtgcttgcagggctctcaaat
aaatctttcctcgctcatattgccgcgtccgggggaaagccggtacggccgacagctgaa
cggctcagcgcaacccttgccgccgaaaccctcgccgtccttaacggcgcagatatcatc
cggacccacgacgcaggtggtgcgaaaacctgcatcagggtagtgcaggctatggtgggt
ctgcatgggtag

DBGET integrated database retrieval system