KEGG   Pelodictyon luteolum: Plut_1852Help
Entry
Plut_1852         CDS       T00291                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
plt  Pelodictyon luteolum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Plut_1852
Enzymes [BR:plt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Plut_1852
Peptidases [BR:plt01002]
 Cysteine Peptidases
  Family C44
   Plut_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2062909..2064765)
Genome map
AA seq 618 aa AA seqDB search
MCGILGWHGGKRPEDRIRFGKALDTLSHRGPDDSGIFEADGIMLGHRRLSILDLSSGGRQ
PMIDPDSGSIIVFNGEIYNYLELRAELEKKGHRFFGNSDTEVLLHALNEWDVSALSRLNG
MWAFAFWQPDRRRLLLCRDRFGVKPLYYRLGDEGFAFASEPKALLELFPGHRAVSEPALL
DFLANNLLFARGESFYKGIKVLPPAHFGEFDYQTCGFKMSRYWDYPESADGSLTVDDAQE
QFDDLFSDAVRLRLRSDVPVGMTLSGGLDSTGVLTAASSFSSATLTSFTSIYSERETGEL
PWAQLASDAVKSRLIPVAAPDDQWLETLGQIARHMDGPGYSPAVYPLWHLMKRARTEGIP
VLLEGQGADEALAGYPQYAVLEMIAYVTGKAGLRRSVSGMKSRIAALNRTFSLPWVLAWT
AREISPAMLRWHRNRVGFHSLMRSGLRLPDCSTQSVSNVADPVRTRLLADHARLILPGLL
HYGDAISMAFGIESRLPFMDYRLVEWMFRLPSSLMFQGNETKWVLREYLRKHGQVKIGNR
PDKKGYPTPAGQWLATEQGLKVERMLLADNNPLHQWCDPVKIRSLIERNRQGAMAADHHL
YKLLSTHLWISECIDRRG
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattcttgggtggcatggcggaaaaaggccggaagatagaatacgtttcggc
aaggcgcttgatacgctgtcgcatcggggaccagatgatagcggcatttttgaggctgac
ggtatcatgcttgggcaccgtcgactctcgatattggatctttcttcgggcgggcggcag
ccgatgatcgaccctgacagcggatcgataattgtttttaacggtgaaatctacaactat
ctggagttacgcgctgagctcgaaaaaaaaggtcaccgttttttcggcaactctgatacc
gaagtgctgcttcatgctctcaatgagtgggatgtcagtgcattgtcccgtctgaacggc
atgtgggcttttgccttctggcaacctgacaggcgccgcctgttactctgcagggaccgg
ttcggtgtcaaaccactctattatcgactgggcgacgaaggttttgccttcgcctctgag
cccaaagcactgcttgagctgtttcccggtcatcgcgcggtatccgaacccgctttgctc
gatttccttgccaataaccttcttttcgcgaggggagagtccttttacaagggaatcaag
gttctaccccccgcacactttggtgaattcgattaccagacctgcgggttcaaaatgtca
cgctattgggattatcctgaatctgcagatggctccctgactgtcgatgatgcccaggag
cagttcgatgatctcttctccgatgcagttcgcctgcggctgcgcagtgatgttccggtt
ggtatgaccttgagcggcggactcgattcgaccggtgtactgacggctgcttcatcgttc
tcttccgccacgctgaccagttttacatcgatctacagcgagcgtgagactggtgaactg
ccatgggcgcaacttgccagtgatgctgttaaatcccggctgattcccgttgctgctcct
gatgatcaatggctcgaaaccctgggtcagattgcaaggcatatggatggtcccggctat
tctccagccgtgtatccgctctggcatttgatgaagcgagcgagaacggagggtattcct
gtattgctcgagggccagggagctgatgaagcacttgccggttatccccaatatgcggtg
ttggagatgattgcctatgtgacagggaaagcaggactccggaggagtgtctcaggcatg
aaaagccggattgccgccctgaatcgaactttttcgttgccttgggtgcttgcatggacc
gcaagggagatctcgccggcgatgctgcgttggcatcggaatcgtgtcgggtttcactcg
ttgatgcgttccgggttgcgactgcccgattgttccacccaatcggtatcgaacgtagct
gatccggtaaggacacggttgctggcggatcatgcgcgcctgatcctgcctggtcttctg
cactatggagacgccatcagcatggcattcggaatcgaatctcgccttccctttatggat
taccggctggttgaatggatgttcaggcttccgtcctctctgatgtttcaaggaaacgaa
acaaaatgggttttgcgagagtacctgcgtaaacacggccaggtcaagatcggaaaccga
cccgacaagaaaggctatccgactccggcaggacaatggcttgccacggagcagggccta
aaggtcgaacggatgctgcttgccgacaacaatccgcttcatcaatggtgtgatccggtg
aaaatccgtagcctgatcgaacgcaaccgtcaaggagccatggctgcagaccatcacctc
tacaagctgctctccactcatctctggatcagtgaatgcatcgaccgaagaggttag

DBGET integrated database retrieval system