KEGG   Pelodictyon luteolum: Plut_1987Help
Entry
Plut_1987         CDS       T00291                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
plt  Pelodictyon luteolum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Plut_1987
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plut_1987
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Plut_1987
Enzymes [BR:plt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Plut_1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2215163..2216479
Genome map
AA seq 438 aa AA seqDB search
MIYFSTSKSSTPVSMKRATLEGLAPDGGLYVPSAIPSFTRQEIKQLEGATFSDVGFAIAK
KFVDGEIPPLELQEIVSECCNFPTPLVQLDPATFVLELFHGPTLAFKDYGARFLARMTGW
FAAEDNRLITVLVATSGDTGSAVAYGFQGIPNTRVVLLYPSGKVSRLQEQQLTTAGGNVH
ALEVKGDFDDCQRLVKEAFVDPSMKERHTLTSANSINISRLIPQSFYYAWATLRLKEDHG
LENPIFSVPSGNYGNLTAGVLAKKMGFPVGGFIAASNANDSVTRYLTDGRYEPRPTRRTL
STAMDVGNPSNFARLIHFYQGEHDAMARDITGTSVTDRETLETIRLVHSRFGYVMDPHTA
VGYCALLRMRQDGVYRENPGVVLSTAHPSKFLEAIHEALQLEIEVPERLGCLLAKEKHST
MIKPDYRDLADFLNGLDH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatctacttcagcaccagcaaatcatccacgccggtctccatgaaacgggccaccctc
gaggggctcgcgcccgacggcggcctctacgtcccctccgccatcccctcgttcacccgt
caggaaatcaagcagcttgagggcgccacgttcagcgatgtgggctttgccattgcaaag
aagttcgtcgacggcgaaatccctccgctggaactgcaggagattgtcagcgagtgctgc
aacttcccgacaccgctcgtccagcttgatccggcaaccttcgtccttgagcttttccac
ggaccgaccctcgccttcaaggactacggcgcccgtttcctcgcccgcatgaccggatgg
ttcgctgccgaggacaaccggctgatcacggtactcgtggcaacatccggtgatacagga
agcgccgtggcatacggattccaggggatcccgaacacccgcgtggtgctgctctacccc
tccggcaaggtcagccgccttcaggagcagcagctgacgacagccggcggcaacgtccac
gcgcttgaagtgaagggtgatttcgacgactgccagcgcctggtgaaggaggccttcgtc
gacccgtcgatgaaagagcgccacaccctcacctctgccaactcgatcaacatctcgcgc
ctcattccgcagtctttctactacgcctgggctaccctccggctcaaagaggaccacggt
ctggaaaaccccatattcagcgttccctccggcaactacggcaacctgacggccggcgtg
ctcgcaaaaaagatggggttccctgtcggaggcttcattgccgcctcgaacgccaacgac
agcgtcacccgctacctcaccgacggacgctatgaaccccgtccaacccgccgcacgctc
tcgacggcgatggacgtcggcaaccccagcaacttcgcgcggctcatccatttctaccag
ggtgagcacgatgccatggcccgcgacatcaccggcacctcggtcaccgaccgggagacc
cttgagaccatccgccttgtacacagccggttcggctatgtcatggatccccataccgcc
gtcggctactgcgccctcctcaggatgcgccaggacggtgtgtaccgcgaaaaccccggc
gtcgtcctttcgacggcccatccgtcgaagttcctcgaggccatccatgaagccctccag
ctggaaatcgaggtccccgaacggctcgggtgccttcttgcgaaagaaaaacactcgacc
atgatcaagccggattaccgcgatcttgcggactttctcaacgggctggaccactga

DBGET integrated database retrieval system