KEGG   Chlorobium luteolum: Plut_1987Help
Entry
Plut_1987         CDS       T00291                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
plt  Chlorobium luteolum
Pathway
plt00260  Glycine, serine and threonine metabolism
plt00750  Vitamin B6 metabolism
plt01100  Metabolic pathways
plt01110  Biosynthesis of secondary metabolites
plt01120  Microbial metabolism in diverse environments
plt01230  Biosynthesis of amino acids
Module
plt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plut_1987
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Plut_1987
Enzymes [BR:plt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Plut_1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABB24829
JGI: Plut_1987
UniProt: Q3B1F2
Position
2215106..2216479
Genome map
AA seq 457 aa AA seqDB search
MQGRRKDTVTNTTAEALPHMIYFSTSKSSTPVSMKRATLEGLAPDGGLYVPSAIPSFTRQ
EIKQLEGATFSDVGFAIAKKFVDGEIPPLELQEIVSECCNFPTPLVQLDPATFVLELFHG
PTLAFKDYGARFLARMTGWFAAEDNRLITVLVATSGDTGSAVAYGFQGIPNTRVVLLYPS
GKVSRLQEQQLTTAGGNVHALEVKGDFDDCQRLVKEAFVDPSMKERHTLTSANSINISRL
IPQSFYYAWATLRLKEDHGLENPIFSVPSGNYGNLTAGVLAKKMGFPVGGFIAASNANDS
VTRYLTDGRYEPRPTRRTLSTAMDVGNPSNFARLIHFYQGEHDAMARDITGTSVTDRETL
ETIRLVHSRFGYVMDPHTAVGYCALLRMRQDGVYRENPGVVLSTAHPSKFLEAIHEALQL
EIEVPERLGCLLAKEKHSTMIKPDYRDLADFLNGLDH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaaggcgcaaggatactgtaacgaacacaaccgccgaagccttaccgcacatg
atctacttcagcaccagcaaatcatccacgccggtctccatgaaacgggccaccctcgag
gggctcgcgcccgacggcggcctctacgtcccctccgccatcccctcgttcacccgtcag
gaaatcaagcagcttgagggcgccacgttcagcgatgtgggctttgccattgcaaagaag
ttcgtcgacggcgaaatccctccgctggaactgcaggagattgtcagcgagtgctgcaac
ttcccgacaccgctcgtccagcttgatccggcaaccttcgtccttgagcttttccacgga
ccgaccctcgccttcaaggactacggcgcccgtttcctcgcccgcatgaccggatggttc
gctgccgaggacaaccggctgatcacggtactcgtggcaacatccggtgatacaggaagc
gccgtggcatacggattccaggggatcccgaacacccgcgtggtgctgctctacccctcc
ggcaaggtcagccgccttcaggagcagcagctgacgacagccggcggcaacgtccacgcg
cttgaagtgaagggtgatttcgacgactgccagcgcctggtgaaggaggccttcgtcgac
ccgtcgatgaaagagcgccacaccctcacctctgccaactcgatcaacatctcgcgcctc
attccgcagtctttctactacgcctgggctaccctccggctcaaagaggaccacggtctg
gaaaaccccatattcagcgttccctccggcaactacggcaacctgacggccggcgtgctc
gcaaaaaagatggggttccctgtcggaggcttcattgccgcctcgaacgccaacgacagc
gtcacccgctacctcaccgacggacgctatgaaccccgtccaacccgccgcacgctctcg
acggcgatggacgtcggcaaccccagcaacttcgcgcggctcatccatttctaccagggt
gagcacgatgccatggcccgcgacatcaccggcacctcggtcaccgaccgggagaccctt
gagaccatccgccttgtacacagccggttcggctatgtcatggatccccataccgccgtc
ggctactgcgccctcctcaggatgcgccaggacggtgtgtaccgcgaaaaccccggcgtc
gtcctttcgacggcccatccgtcgaagttcctcgaggccatccatgaagccctccagctg
gaaatcgaggtccccgaacggctcgggtgccttcttgcgaaagaaaaacactcgaccatg
atcaagccggattaccgcgatcttgcggactttctcaacgggctggaccactga

DBGET integrated database retrieval system