KEGG   Pelodictyon luteolum: Plut_2022Help
Entry
Plut_2022         CDS       T00291                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
plt  Pelodictyon luteolum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plut_2022 (pfkA)
   01230 Biosynthesis of amino acids
    Plut_2022 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plut_2022 (pfkA)
   00030 Pentose phosphate pathway
    Plut_2022 (pfkA)
   00051 Fructose and mannose metabolism
    Plut_2022 (pfkA)
   00052 Galactose metabolism
    Plut_2022 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Plut_2022 (pfkA)
Enzymes [BR:plt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Plut_2022 (pfkA)
Protein phosphatases and associated proteins [BR:plt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Plut_2022 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2250264..2251286
Genome map
AA seq 340 aa AA seqDB search
MTRNNDNEGLSFTSSRIKKIGILTSGGDAPGMNAAIRAATRSTIAAGREAVGILRGYQGM
IDGEFLPLQSSDVSGILQLGGTMLKTARCKAFRTPEGRRKAGEQLKAAAIDAVIVIGGDG
SFTGAWVMSQECDIPFVGIPATIDNDMYGTDYTIGYETALNSVVCAVDKIKDTARSHGRI
FFIEVMGHEAGLLALNGGIACGAEVILIPESKAQHDELQKFLEKGYRDKESSGIVMVAEG
DEAGGALHIAEQAQRDHPDLDVRISILGHIQRGGSPVARDRINATRMGIAAVDALLNDQK
SIMIGLDNDRIVHVTFNKAVKMNHSIDTGLLEVHNLLNGM
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcaataacgataacgaaggactttcattcacgtcgagcagaatcaaaaaaata
ggcatactgacctcagggggcgatgcgcccggcatgaatgccgccatcagggcggcaacc
cggtcaaccatagccgcaggacgggaggccgtcggcatcctccgtggctaccagggcatg
attgatggggagttcctccctctgcagtcatcggacgtcagcggcatcctgcagctcggc
ggaaccatgctcaagacggcccgctgcaaagcattccgcacgcccgaaggacgccgcaag
gccggggagcagctgaaggccgcggccatcgacgccgttatcgtcatcggcggcgacggc
tcgttcaccggagcctgggtcatgtcgcaggagtgcgacatcccgttcgtcggcattcca
gccaccatcgacaacgacatgtacggaacagactataccatcggttatgaaacggccctg
aactctgtggtctgcgcagtcgacaaaatcaaggacacggcccgctcgcacggacggatc
ttcttcatcgaggtcatgggccacgaagccggcctcctcgccctcaacggcggaatcgcc
tgcggagccgaggtcatcctcattcccgaatcgaaagcccagcacgacgaactgcagaaa
ttcctggagaagggataccgcgacaaggagtccagcggcatcgtcatggtggccgaaggc
gacgaggccgggggcgccctgcacatcgccgaacaggcccagagggatcaccccgacctc
gatgtgcgcatctcgatcctcggccatatccagcgtggcggaagccccgtggccagggac
cggatcaacgccacacggatgggcatcgccgccgttgacgccctcctgaacgaccagaaa
agcatcatgatcggcctcgacaacgacaggatcgtgcatgtgaccttcaacaaggcggtc
aaaatgaaccacagcatcgacaccggccttttggaggtgcacaacctgctgaacggcatg
tag

DBGET integrated database retrieval system