KEGG   Pelodictyon luteolum: Plut_2055Help
Entry
Plut_2055         CDS       T00291                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
plt  Pelodictyon luteolum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Plut_2055
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Plut_2055
Enzymes [BR:plt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Plut_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2284867..2286003
Genome map
AA seq 378 aa AA seqDB search
MSQRVPVFLALLLFALLLQPPPIAEAGTKPDSLSIKIGQMLMVGFRGTTIGDAPDVRRAI
DRQRIGGVVLFDYDVPSRTPLRNITGPEQLQRLNGELQERSPVPLFISIDQEGGMVSRLK
PARGFPRSPSARSLGLLRNPDSTLAAAEVTARTLQSMGVNMNLAPVVDLDTNPQNPVIGR
IERSYSPDPDIVSSQAAIVTTTFLREGIIPVLKHFPGHGSSTSDSHLGFTDVTESWSEIE
LEPYRSLLLDGYQGAIMTAHVFNARLDPRYPATLSKATISGLLREKLGFRGVVLTDDMQM
GAIAQNFGFEEAVRLSIEAGADILVFANNTAVYDPKIAEKASGIIRRMVDEGIISPLRIE
ESYRRIMTLKETVTHPAR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagagggtccccgtctttcttgcgctgctgctcttcgccctcctcctccagcca
ccgcccatcgcagaagcgggaacgaagccggacagcctatccattaaaatcggccagatg
ctgatggtgggcttcaggggcaccaccatcggcgatgcccctgacgtacggcgcgccatc
gaccgccagcgcatcggcggcgtggtgctcttcgactatgacgtcccgtcccggaccccg
cttcgcaacataaccggcccggaacagcttcagcggctgaacggcgaactgcaggagcgt
tcccccgtcccgctcttcatttcgatcgaccaggaaggcggcatggtcagcaggctcaag
ccggcaagggggttcccccggagcccgagcgcccggagcctcggactgctcaggaacccc
gacagcaccctcgctgcagcggaggtgactgcccggacactgcagtcgatgggagtcaac
atgaaccttgcgccggtggtcgaccttgataccaacccgcagaatcccgtcatcggccgt
atagagcggagctactcgcctgaccccgacatcgtctcgtctcaggccgccatcgtcaca
acgacctttctccgcgaggggatcatccctgtcctgaaacattttcccggccacggcagc
tcgacctcggacagccatctgggcttcaccgacgtaacggaaagctggagcgagattgaa
cttgaaccataccgcagcctcttgcttgatggatatcagggtgccatcatgaccgcccac
gtcttcaacgcccgcctcgatccccgctatccggcgaccctttcaaaggcgaccatcagc
ggcctactacgagaaaagctcgggttccgtggggtggtgcttaccgatgacatgcagatg
ggcgccattgcccagaacttcggctttgaagaagcggtccgcctgtcgattgaagccggt
gctgacattcttgtgtttgccaacaatacggccgtctacgacccaaaaatcgcagaaaag
gcatcaggcatcatccgcaggatggtggatgagggcataatttctccccttcgcatcgag
gagtcgtaccggaggatcatgacactcaaagagactgtaacccaccctgccagatga

DBGET integrated database retrieval system