KEGG   Pelodictyon luteolum: Plut_2085Help
Entry
Plut_2085         CDS       T00291                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
plt  Pelodictyon luteolum
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Plut_2085
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Plut_2085
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Plut_2085
Enzymes [BR:plt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Plut_2085
Exosome [BR:plt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Plut_2085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2317709..2319184)
Genome map
AA seq 491 aa AA seqDB search
MQRTWITLSLLLLLLPGCSVRNTAIGDAVETSVPTAPPARHVFLFIGDGMGLAQVELARA
LLPEGDSLAMTSLPVTGLVSTHALDHYITDSAAAGTALATGHGTMVGTIAMGSNRLDTLK
TIVEIAETAGMRTGIVTSVGIDNATPACFYAHSPSRTRIHDIASQMVGSGVDYFAGGYAE
GNFPLMRARAELDYGDIDSLMLAGGYRIARNARELREVQPGKPVWAYGQYGRSAAMAFAM
DADSREMDLAAYTGEGIRLLENPKGFFMMVEGGKIDWACHGNDAAAVAHDVASFDRAVRQ
ALAFYRSHPSSTLIVVTADHECGGLSLGNTAGGYESRPRLLLNQKLSLERFMDKVALWRS
ERRVTFPMALDSLEVFFGLGSPRDSALVLSARNRRELQVAFTSSMAPFPAPDRFSPAVSA
ILNRRAGIGWGSRVHTAVPVPVFAIGAHAGMFSGSYPNTVLGQRLMQAAGFSGATDPHPG
EFSPAPARSAP
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggacatggattaccctctcgctcctcctccttctcctgccgggttgttcggta
cgcaacacggccatcggggatgccgtagagacgtctgtcccgacagcaccacccgcacgc
catgtgtttcttttcattggcgacggcatggggctggctcaggttgaactcgcccgtgca
ctcctcccggagggggactcgcttgcgatgacctctctgccggtcactggactcgtctcg
actcatgcccttgaccactacataactgattctgcagctgcaggaactgctctggccacc
gggcacggcacaatggtcggcaccatcgccatgggcagcaaccggctcgacaccctcaaa
accattgtcgaaattgctgagactgcgggtatgcggaccggcatcgtcacgagtgtcggc
atcgacaatgccactccggcctgcttttacgcccatagcccatcgcgtacgcgcattcac
gacattgccagccagatggtcggtagcggtgtcgactatttcgctggcggatacgctgaa
gggaacttccctctcatgcgggcacgtgcagaactggattatggtgacatcgattccctg
atgctggccggcggctaccggattgcaaggaacgcccgtgaactgcgggaggttcagccg
ggcaagcccgtctgggcgtacggtcaatatggccggagtgctgccatggcttttgccatg
gacgccgattcccgggagatggatctcgcggcatacaccggcgaagggatccgtctgctt
gagaacccgaagggatttttcatgatggtggagggcggaaagatcgactgggcctgccat
ggcaatgatgcggcggcggtggcgcatgatgtggcatcattcgaccgggctgtccgtcag
gcgctcgcattctatcgaagccacccctccagcaccctcatcgtcgtcaccgccgaccat
gaatgcggcggactcagtctcggcaacaccgccggcggatacgaaagccggccccggctg
ctcctcaaccagaagctgtcgcttgagcgcttcatggataaggttgcgctgtggcggagc
gaacggcgggtcaccttcccgatggcgcttgacagcctcgaagtgtttttcggtctcggt
tccccccgtgactccgcgctagtgctctctgcccgaaacaggcgggagctgcaggtggcg
tttacatcctccatggctccgttcccggcccctgacaggttttctccggctgtcagcgcg
atcctgaatcgccgggcgggcatcgggtgggggagcagggtgcatactgcggttccggtc
cccgtgttcgcgatcggagcgcatgctgggatgttcagcggctcctacccgaacactgtt
ctcggtcaacggcttatgcaggcagccgggttctccggcgctacggaccctcatcccggg
gaattttcccccgctccggcgcgttctgcaccatga

DBGET integrated database retrieval system