KEGG   Pelodictyon luteolum: Plut_2086Help
Entry
Plut_2086         CDS       T00291                                 

Definition
lysophospholipase L2
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
plt  Pelodictyon luteolum
Brite
Enzymes [BR:plt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Plut_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2319316..2320098)
Genome map
AA seq 260 aa AA seqDB search
MVTIHAGTAGRSPFGVLVIHGFTANRESVELLLKPLQSLGIPVSIPVLAGHGGPSPAALK
GLRWQDWLNDAEAAFRELAERADRIIVVGHSMGALLALNLAVRHPGKVDALVLVATAIRL
VSVLAPGRPLHFAAFPISLMVKRWGLKSVFADPEGAVCRGHYEWVPTDAVLSFFRLIRKT
QKLLAAVHCPVFILHNRSESTVLPESVGILNSSLGTPDSDRSVLWLSRSGHQVFCDCERE
DAVEAIVRYVSGRMGRSEER
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccatacacgccggaacagcggggcgaagccccttcggggtgctcgtcatccac
gggttcacggcgaacagggagagcgtcgagctcctccttaagccacttcagagccttggc
attccagtttccatacctgttcttgccggtcatggaggtccttcgcccgcagccctgaag
gggttgcggtggcaggactggctcaatgatgccgaagcggcgttcagggaactcgcagag
cgggctgaccgcatcatcgtggtcggccacagtatgggtgctctgcttgccctcaacctt
gcggttcgtcatcccggaaaggtcgatgccctggttcttgttgctacggccattcgtctg
gtctcagtgcttgcgccgggccgtccgctgcattttgccgcttttccgatcagcctcatg
gtaaagcggtggggcttgaagtccgtttttgccgatcccgagggggcggtctgccggggg
cattacgaatgggttccgaccgatgcggtcctctcgtttttccggctcataagaaagacc
cagaagctgctcgctgcggtgcattgtcccgtattcattcttcataaccgcagtgagagc
acggtgcttcctgaaagtgtcggtatcctcaacagctcactcggcacgccggattccgat
agatcggtcctatggctcagccgttcaggacatcaggtgttctgcgattgcgagcgcgag
gatgctgtcgaagcaatcgtccgttatgtgtcggggcggatgggccgcagtgaagagcgt
taa

DBGET integrated database retrieval system