KEGG   Pelodictyon luteolum: Plut_2115Help
Entry
Plut_2115         CDS       T00291                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
plt  Pelodictyon luteolum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Plut_2115
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Plut_2115
Enzymes [BR:plt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Plut_2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2346996..2348567)
Genome map
AA seq 523 aa AA seqDB search
MNPNTALDGMQPVALREILRGMGAYEVAAGQTDGVMVRMLTNDSRVVEPGSLFVAVRGFA
ADGRGFIKDAIARGASAVVSEDFPMELALNGPPCIRVPDARRALSLAAAAYYGHPADRLR
IVGVTGTNGKTTTARLISSILSMNGISCGYIGTGKAIIGDREIPLERTTPEAHGLHRLFR
MMVDGGCRAVSMEVSSHALELGRVHGIAFQAAVFTNLTPDHLDFHPSMESYAEAKRKLFD
QLAPGGIGIFNTEDPMATFMAARVAEEQRACCSLDAAGFGGMRCGLNYGAMVRREGVGSS
VVALSFPEGVQPEEEFRLLGRFNVMNMLEAAAAAHQLGVPARDVAASLPGLQGVEGRMEQ
VEGPGFEGTAIVDYAHTPDALHQSLGTLRELLPPDGRLLVVFGCGGNRDRQKRPEMGRIA
IEMADFSVITSDNPRDEDPEAILDEIEGGMGGGEHLRIPDRAEAIRTAVGMLRSGDILLV
AGKGHECYQETHGRREHFSDREVLAAGIAQENGEKNPEQEARE
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaaacaccgcattggacggtatgcagccggtcgctctccgggagattctccgg
gggatgggggcgtatgaggtcgcggcaggacagacggacggggttatggtccggatgctc
accaatgactctcgggtggtcgagccgggatcgctgttcgttgcggtcaggggatttgct
gcagacggtcgagggttcatcaaggatgccatcgcacggggcgcctcggcggtggtctcg
gaggacttccccatggagctcgctttaaacggcccgccctgcatccgggttccggacgcc
cgcagggctctcagccttgctgctgcggcatattacggccatccggccgaccggttgagg
attgttggggtgaccggtacgaacggcaagacgacaacggcacgcctcatctcctccatc
ctctccatgaacggaatttcctgcggctacatcggcacgggcaaggctatcatcggagac
cgggagatcccgctggagcggaccactcccgaggcccacgggctgcaccgcctgttccgg
atgatggtagatggtggctgccgtgcagtttcgatggaggtctcctcgcatgcactcgaa
ctcgggcgggtgcacggcatcgcatttcaggcggcggtgttcaccaacctgacgcctgac
caccttgatttccatccgtcgatggagtcttatgcggaagccaagcgcaagctgttcgac
cagcttgcgccgggcggtatcgggatattcaacaccgaagacccgatggctacgttcatg
gcggccagggtagcagaggagcagcgagcctgttgctcacttgacgctgctgggttcggc
ggcatgcggtgcggccttaactatggcgctatggtccgcagagagggtgtgggttcctct
gtggtcgcgctttcgtttcccgagggcgtgcagccggaagaagagttccgcctgctgggc
cggttcaatgtgatgaatatgcttgaggccgccgctgcagcccatcagctcggggttccc
gcccgggacgttgccgcatcgcttcccgggcttcagggcgttgaagggcggatggaacag
gttgagggtccaggcttcgaggggacggccattgtcgattacgcccacacccccgatgcg
ctccatcagtcgctcggcaccctgcgggaacttcttcctccggatggacggcttctcgtc
gtgttcgggtgcggcggcaaccgcgaccggcagaagcgcccggaaatggggcggatcgcc
atagagatggccgacttttcggtcatcacctccgacaacccccgagacgaggatcctgaa
gcgatccttgacgagatcgaggggggcatgggcggaggagaacatcttcgcatccccgac
agggcagaggccataaggacggcggtcggcatgcttcgttccggagacatcctcctcgtc
gcaggcaaggggcacgagtgttatcaggagacccatgggcggcgggagcatttctcagac
cgcgaggtgctggcggcaggcattgcacaggaaaacggcgaaaagaaccccgaacaggaa
gcgagggaatga

DBGET integrated database retrieval system